SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM048780-PA|EEB10569.1|cAMP-dependent from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM048780-PA|EEB10569.1|cAMP-dependent
Domain Number 1 Region: 126-383
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-74
Family Protein kinases, catalytic subunit 0.0000000707
Further Details:      
 
Domain Number 2 Region: 19-159
Classification Level Classification E-value
Superfamily SH2 domain 3.9e-37
Family SH2 domain 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM048780-PA|EEB10569.1|cAMP-dependent
Sequence length 402
Comment protein kinase catalytic subunit, putative|DS235020.1:39674:41378:1|gene:PHUM048780
Sequence
MAENSKLSPTLAQKAEIKLNTMPWFHGKISRDRAEQLLTPKEDGLFLVRESTNFPGDYTL
CVCFQGKVEHYRVKYKENQLTIDDEEYFQTLAQLVGHYEQDADGLCTQLTKCLPKKGKQD
ICVATKDFADAGWMIQTSELELRESIGKGEFGDVLLGVYRGNKVAVKTLKDSSEAAQKLL
TEALLMTSLRHENLVEMLGLVFSNNHIYLVTEYMSKGSLVDYLRSRGRLHVTKNDQINFA
FDTCSGMEYLESRKVVHRDLAARNVLISEEGVAKVSDFGLAREENFTLDAGKLPIKWTAP
EALRQGLFSNKSDMWSFGILLWEIYSFGRVPYPRIPQADVVKHVEKGYKMEAPEGCPQEI
YEIMRQTWDLHPEKSPSFKDIKTKLSHLKSSIVGLIEDIMHH
Download sequence
Identical sequences E0VB13
vb|PHUM048780-PA|EEB10569.1|cAMP-dependent XP_002423307.1.24195 121224.XP_002423307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]