SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM051580-PA|EEB10611.1|protein from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM051580-PA|EEB10611.1|protein
Domain Number 1 Region: 444-545
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-18
Family Pleckstrin-homology domain (PH domain) 0.0072
Further Details:      
 
Domain Number 2 Region: 41-164
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000196
Family Pleckstrin-homology domain (PH domain) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM051580-PA|EEB10611.1|protein
Sequence length 1336
Comment outspread, putative|DS235022.1:50889:58890:1|gene:PHUM051580
Sequence
MSSSSGRAECRKFTPNIFNKTKCTSCFRQKEEHSAEALESNRVTRKISKCGYLFVAPGWD
FSIPINRTKRWQRRWFVLYDDGELNYSLDEHPDSDFTSIDMNKVMEVSDAEEITGNLYSI
AITASDGIHFVKGTTREEARWWKDVLSGRHKRNATFPVSQPSSILQQASLNCRSSTENRP
RFNSVRTDSDVVLHSNSSKWLNVESDIYPTRDVQVKVEQSESNNNNKTDSEQTPTIIADD
KKSYSNRHPVSSFSPPTRDKVNSDERTKTRKSLNREKRSLKLDKEMFAVEKSEENFGDEF
PSTKKNKNSDQSITKILREGSSDKNDETRRLLLESEKSKRKEKLKDIADSLTKPRLRRNI
TNEYMSLECKTKNQIKPTRDGECSEDERESSGTPISPMEKNELNPVREKAVRGDPDGCNL
DVSLCDYPPDSELRVDLPAEELLNIKKGWLLKQGSGKEWTKHWFVLRGVALMYYRDPTAE
DKGILDGVMDLSSIKSVSEIQVQRNYGFQTVAWDDKKYVLSAATAGIRSNWIAALVKAAG
LVKNFEKGSLKINEKLERDLDKPPSPTPLPPSPPLNRTPISKVKERAKTQTTRSRVYNKR
SKSSPPTSRKAHTLHRSCETSHEEKREEPIKRSAILDKVDRHVKEIDELKGQLSLALCEK
TTAEKELSRLRQRKTDANQQVEELLRNLKIAENELKLKSQELENFEKLKQRYSALLKEHE
GMLNEENVQVLKSELTNLSERLMRGLEENEGLYGRMRELEGRCLSSSRERGRSVDSLSDL
TNVDLDINLETLNKERIIEEYEELKGRFEKAVQEIRAMKKELRESHANYDDLELTVINLR
QDAKRKEENGKAQAELMASRIEDLTLKLSASEKQSRVLKQKIAKSDSREKRRSLSLKGKE
SFYIGKETEEKLAELEAKLEALESGKQTSESKKQEFKADKRLQKAWSLAQESLNKELAQV
ELSQLALRFGQRTRGKIDELDFETRFIYLYQKFSAECLKSVEGSKFCLNNSAAVLKNLKH
SVEKIKNLREMLQLPESSTSLPSLSHSNSNNILDHSAFISNQLEDFTKGKHLCRQCCLLK
EALRNDLMGELEYQKNSLVCQHEIEQAQLVEKTKCLEKRLETLDVEYSQQINGLRMAYHK
TISTDLDGKDESSVDSIRLRYQAEIEQLRTLCEKGLSAVDNSHRRIITELEEKHRQELAA
AAAEKEQALAEETQATLAALDAMRKAHETEVQKEIAKFKSEFLKKMQSNHDIGALHKEHE
AEMEEIKKEILSLSEKYSVKCVESASLEEQLSNMSKQLNQAHEHIMQLDARNKQLRSYIV
SRRSEPGEDSLNELKE
Download sequence
Identical sequences E0VB55
XP_002423349.1.24195 121224.XP_002423349 vb|PHUM051580-PA|EEB10611.1|protein

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]