SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM051940-PA|EEB10617.1|Plexin-A4 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM051940-PA|EEB10617.1|Plexin-A4
Domain Number 1 Region: 43-464
Classification Level Classification E-value
Superfamily Sema domain 4.45e-108
Family Sema domain 0.000037
Further Details:      
 
Domain Number 2 Region: 1325-1449,1653-1804
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.12e-43
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 816-907
Classification Level Classification E-value
Superfamily E set domains 0.000000000000229
Family Other IPT/TIG domains 0.029
Further Details:      
 
Domain Number 4 Region: 476-528
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000144
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 5 Region: 966-1036
Classification Level Classification E-value
Superfamily E set domains 0.000000000103
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.077
Further Details:      
 
Weak hits

Sequence:  vb|PHUM051940-PA|EEB10617.1|Plexin-A4
Domain Number - Region: 1106-1173
Classification Level Classification E-value
Superfamily E set domains 0.000105
Family E-set domains of sugar-utilizing enzymes 0.06
Further Details:      
 
Domain Number - Region: 779-812
Classification Level Classification E-value
Superfamily Plexin repeat 0.000178
Family Plexin repeat 0.0053
Further Details:      
 
Domain Number - Region: 909-964
Classification Level Classification E-value
Superfamily E set domains 0.00249
Family Other IPT/TIG domains 0.085
Further Details:      
 
Domain Number - Region: 626-660
Classification Level Classification E-value
Superfamily Plexin repeat 0.0379
Family Plexin repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM051940-PA|EEB10617.1|Plexin-A4
Sequence length 1873
Comment precursor, putative|DS235022.1:113521:132982:1|gene:PHUM051940
Sequence
MSLTATLLLGLIVPIAVISHDTKSLSVSVPISSKIQQITSRFSLNGDTSFTHMVYDKTGN
QIFAGAINKIYRLDENLKLMEEVTTGPKQDSPLCPAKGCDSSVTEKFSTNNVNKLLILDP
ESKSLIACGSILQGACEKYNTSSLFVPPKFISLSVAANDEKSSTYAFIGPESYNSRNRNN
VLYVGTTFTNHGEYRHDVPAISSRNLDDLNFAAFSFSKQSLLRIDVKYRDQFLVNYVYGF
NSTEFAYFVIVQKQSHLPGQEEKGYVSRLARTCISDENYDSYTEVTLQCTIRSETTNKLV
NYNLIQDAKIGVAGADLAGNLGIDTNENVLVGIFSPSKGITNEPQSKSAVCVFSLQEIEA
KFTENIHMCFNGSISDRNLGYVSGLILDGKCPTAGSTGNIPYFCEVGLKISGVVPIKGGA
FLHFPNETLTSVTLGKTERHTVAFLGTKNGHIKKHKLHVNFFFSFFFQITKLKIEHCGSY
GNCSACLDARDPYCGWCSLEKRCIIRSACQKASYSSPRWLSVGGGQQCIDFEYVHPDRIP
INQMTTVTLAIRTLPELPAGAKYKCVFGKSHPIDANVTSTGLICLTPNITERSFIPENMD
HVLVPLSVRSSETNKDFVSRNFAFYDCGRHTTCKKCVTSQWQCNWCVYQNQCTHNTTTCQ
RLGSISLDQHNSAFRKTNETIFLPNKVSKEIVLDVENLPHPQFVHVGFLCIINIEGAKMM
VPARVEKNRFVICDKTVYSYEAKMGEYKANVTVVWNKNHHVDTTSVTLYKCNILGSHRDH
PDCSLCASSHSQYNCTWCGTSCTYKDSCQHSSFVECPKPRIDMVKPLNGPVEGGTLVTIE
GSNLGLKSEDVKEKIRIGNTTCHLVDYEISVRIVCRTGPSLVGESIVPITVGNKAGFTES
SVRFSYKKGVYPAMGPQSGGTQLAITGKNLNIGTSSTRLTCITSKKLTLFVDGANRTFDK
YPFNYTLDPTILEIKPLKSFASGGRMITIHGTNLHAIQKPEMTVHLDHELNPINKSICTV
ISSAQMECPSPSIDLTLLAKNFNRSKAERENVPKWGRSLVKFHMTQIPLQIGFIMDNVDS
IKDLEKYFPNLRSQLLYVTDPKFFEFPNTIKSYKGDTLVIEGENLNLASDETDVNVTIGM
ASCNVTSLALTQLVCTPPEIQPEPTDEYGFKTSTSLPLVVVRVGKILRFPVGYLQYEVMK
PYSFSPEAIAGIVVGTCFVVFLFLIILVIYRRKSTQAEREYKRIQIQMDTLESNVRSECK
LAFAELQTDITDLTADLESTGIPTLDHKSYVMKVFFPGVSDHPILNDPKPRSNCLRTNYD
AAMFQFEQLINNKNFILVFIETLENQKTFNIRDKVSVASLVMVVLMSKMEYATDVLRSLL
FKLIDKSVGTKYPQLMLRRTESVVEKMLTNWMALCMYNYLKDYAGSSLFLLYKAIKHQVE
KGPVDAITHDARYSLSEERLLREQIDHNIITIHLIQEDLHYEKIPYQTYQVLQDAALEAK
LQCKVLDCDTISQVKSKIFDALYKNTHFSMRPSIQEVDLEWRHGRGGHLILQDEDLTTKS
TGTRKKLNTLAHYGIKDSAIMSLIPRQQETYCTQSYRFKNYITTSSNPPIILSNGILEED
SNSKFYHLVKPIDENQFLNKMGPTDRTHKAIPEIFLTRLLSTKGTIQKYVDDFFTTILSA
DEGLPPAIKWLFDLLDDAAKRHSIVDPEVLHAWKSNSLPLRFWVNFIKNPDFIFDINKTA
TVDSCLSVIAQTFMDACSTTEHRLGKDSPSNKLLFAKDIPQYRDMVTRFYSNIRTSPQIT
DQEMSTVMQQLSTSQTEEFDIIAALKELYIYVSRYNGQIIQALETDPICKKMHLAHKLEN
VACTLEGEETSTC
Download sequence
Identical sequences E0VB61
121224.XP_002423355 vb|PHUM051940-PA|EEB10617.1|Plexin-A4 XP_002423355.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]