SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM052780-PA|EEB10621.1|Plexin-A1 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM052780-PA|EEB10621.1|Plexin-A1
Domain Number 1 Region: 27-490
Classification Level Classification E-value
Superfamily Sema domain 3.79e-122
Family Sema domain 0.0000284
Further Details:      
 
Domain Number 2 Region: 1364-1495,1699-1887
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.06e-43
Family p120GAP domain-like 0.039
Further Details:      
 
Domain Number 3 Region: 849-945
Classification Level Classification E-value
Superfamily E set domains 0.000000000000331
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 4 Region: 493-544
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000353
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 943-1032
Classification Level Classification E-value
Superfamily E set domains 0.0000000000204
Family E-set domains of sugar-utilizing enzymes 0.06
Further Details:      
 
Domain Number 6 Region: 1049-1132
Classification Level Classification E-value
Superfamily E set domains 0.0000000369
Family E-set domains of sugar-utilizing enzymes 0.035
Further Details:      
 
Weak hits

Sequence:  vb|PHUM052780-PA|EEB10621.1|Plexin-A1
Domain Number - Region: 807-839
Classification Level Classification E-value
Superfamily Plexin repeat 0.000157
Family Plexin repeat 0.0033
Further Details:      
 
Domain Number - Region: 1163-1211
Classification Level Classification E-value
Superfamily E set domains 0.000224
Family E-set domains of sugar-utilizing enzymes 0.051
Further Details:      
 
Domain Number - Region: 639-677
Classification Level Classification E-value
Superfamily Plexin repeat 0.0017
Family Plexin repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM052780-PA|EEB10621.1|Plexin-A1
Sequence length 1919
Comment precursor, putative|DS235022.1:167827:180619:1|gene:PHUM052780
Sequence
MKKMVTMMLTLLGGFGLISPTRCTIIKSFADEQIEKFNHLVVDKNTGRVFIGAINKLYQL
SPDLELVISESTGPHEYSSQCSVLDCLPTIVKKLTDNVNKALVIDYTTSRLIVCGSLFQG
TCSVRNLHNISDVVQSVKEAVVASNKTASTVAFIAPGPPNPPVTQVMYVGVTYSGGNSPY
SSEVPAVCSRSLDPNKMFTIAKTAVTTGTRMFVNSLARERYLINYVYGFSSGGFSYFLTN
QMKSTQASPFISKLVRICHDDPNYYSYTEIPIECTTTTTGKSEKIKNFNLVQAAYVGKPG
SDLAADLGITAQDDVLFAVFSETDLSEGETSSKPAPSSGLCVYTLKSIRRKFMENIKTCF
EGKANRGLDFVSTGHHCVPTKLQSISEDFCGLDVNTPLGGESPIQTEAALAFNDLLTAVA
ATSTGDYTVVFLGTGNGHLKKVVVEGSSSALQYGDEIIDENSATNPDLYFDAQQIHLYVM
TERRVSKVKVQECSVYKTCWDCLNAKDPYCGWCSLENKCSLRSDCQDAAKDPLYWISYKS
GRCTTITTVTPNQLQRTTARTLELVIDNLPTLPGQFLCAFTALDKVLITNATRKSYGVNC
TTPRTDLLPSIPAGQHHFVSRLSVRMTSGPDFVQTNFTFFDCNTYSSCTQCVSSMFPCDW
CVDGHRCTHDTAENCRNDILVTGVSRIGPSYRSGPGFCPTINATAEGSPEILAPSGMKKV
IKVKVHIIGQFIVQTRFVCQFNIEGRVTHVNARLLGDTIYCENMEFSYTSRAPNITVPFA
VIWGGSKPLDNPDNVHIVIYRCRDMADNCGMCLALSEKYECGWCQSADRCEVKDQCDQGS
GVWLDREQTCPNPEVYEFEPMMGPWEGGTNITIRGINLGKSFQDIYGGVMVAGVQCEPYK
ELYIKTKEIICKVDGPGSSKPRSGPVIVKVEDFRGESKSNYNFVDPQIYGISPTFGPKSG
GTVLRIKGKFMNAGSRTLAFIDELPCEINSTSSDEAICITSSSDKQRTGALRMKFDKGDR
YFDKGSFEYVEDPTIESAESGPLSQLKIPKGIPAGGIKISVVGKNFVSIQNPQMYVYYDN
KKFVSDCTVLSNTNMQCSSPQIQVPNDVVIDPDQPLPLLYGFHMDKVLGVQNLSVKQGYP
PFSLYPNPVYEPFDEEIKHYKSDYLTINGQHLDRASQETDVSVQIGSSVCNVTSLSRQQL
TCRPPETQPPPVDAEGTSDQHSLPEVVVIVGGSLRYKIGKLSYTSLTGSAGPLTKPTVIA
IVVVILVIFVIFLCFLIAYRRKSTESSRVLKNMQEQMDILELRVAAECKEAFAELQTEMT
DVTGDLTSGGIPFLDYRSYAMKILFPNMEDHAVLQLERSELHHKEKALRIFGQLIINKTF
LLLFIRTLESNRYFSMRDRVNVASLIMVTLQGKLEYCTDILKTLLAELIEKCMEGKSHPK
LLLRRTESVAEKMLSAWFTFLLYKFLRECAGEPLYMLFRAVKQQVDKGPVDAITSEARYS
LSEEKLIRQSIDYKPMTVFVSISQQTIFSGGLDPNTENVPVKVLDCDTISQVKEKALDTI
YRAIPYSQRPRKDDLDLGTTGTSGRLILYDEDTTTKTEGEWKKRNTLNHYRVPDGGMLNL
VSKQSSMYNLTILSDKTDKSHKYETLNSSKYAAASPPLSRATSPLNHDHEGGIKIWHLVK
HHDNDPQKEGERGNKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYM
FDFLDDQALLHGITDPEVVHTWKSNSLPLRFWVNLIKNPNFVFDIHKSNIVDSCLSVVAQ
TFMDSCSTSDHRLGKDSPSSKLLYAKDIPAYKEWVERYYSDIKLMPAISDQDMAAMLAEE
SRLHSTEFNTNCALYELYSYATKYNEQLMVTLEEDEFSQKQRLAYKLEQVHNSMVDHNP
Download sequence
Identical sequences E0VB65
vb|PHUM052780-PA|EEB10621.1|Plexin-A1 121224.XP_002423359 XP_002423359.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]