SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM055000-PA|EEB10634.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM055000-PA|EEB10634.1|conserved
Domain Number 1 Region: 35-217
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.19e-24
Family Clostridium neurotoxins, the second last domain 0.0099
Further Details:      
 
Domain Number 2 Region: 350-445,546-750
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000403
Family Armadillo repeat 0.085
Further Details:      
 
Weak hits

Sequence:  vb|PHUM055000-PA|EEB10634.1|conserved
Domain Number - Region: 2119-2171
Classification Level Classification E-value
Superfamily PH domain-like 0.0209
Family PreBEACH PH-like domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM055000-PA|EEB10634.1|conserved
Sequence length 2211
Comment hypothetical protein|DS235023.1:295797:311196:1|gene:PHUM055000
Sequence
MLGVLASYSITVKELKLLFGAMKAHNGKWPRHSAKLLNVLRQMPHRNGPDVFFSFPGRKG
SAIVLPPLARWPYENGFTFTTWFRLDPINSVNIEREKPYLYCFKTSKGVGYSAHFVGNCL
VLTSMKVKGKGFQHCVKYEFQPRKWYMIAVVYIYNRWTKSEIKCLVNGQLASSTEMVWFV
STNDPYDKCYIGATPELDEERVFCGQMAAIYLFSEALNTQQICAMHRLGPGYKSQFRFDN
ECTLSLPDNHKRVSGDLLMSPYTTVGELENPELRNALLCPLVVLDEASKSVLYDGKLSSA
IVFMYNPVATDGQLCLQAAPKGNVSYFVHTPHALMLQVTIITHSIHSTLNSIGGIQVLFP
LFSQLDLPYDSKRDSSLCFKLLGFICELVESSHTVQQHMIQNRGFLVISYMLQRSSRQHL
TIEVLDSFLNLTKYLVTCLSSNNELLLKQLFCFSFLTWQLLDHVLFNPALWIYTPAPVQT
RLYSYLATEFLADTQIYSNVRRVSTVLQTVHTLKYYYWVVNPRAKSGITPKGLDGPRPPQ
KDILAIRAYILLFLKQLVMLGNGVKDDELQSILNYLTTMHEDENLHDVLQMLISLMSEHP
AAMVPAFDAKQGVRTVFKLLASESQLIRLQALKLLGFFLSRSTHKKYDVMSPFNLYTLLA
EQLLVNDEVLTLPTYNVLYEIMTEHISQQILYTRHSEPESHFLILKVVATLIRQSKQSEQ
LLEVKKLFLSDMTLLCNNNRENRRTVLQMSVWQEWLIAMAYIHPKTSEEQKISDMVYSLF
RLLLHHAIKHEYGGWRVWVDTLAIVHSKVSYEEFKLQFAQMYEHYEKQRSDNITDPAVRQ
QRPISTISGWDQQQSAQGSNNFQQPGWSNNPDAENKMAKGNEICNCEMNAENGLIPSAYV
EKSQQPSLLETAEESFADNLNKTTGKSFRENSPNEKNSNSEKIVKTPDDDDDNEIEKDKD
VNLSSDILKTNNYTHENDKKETDTEVKREPLLLDSVDVEKEMKETKNDDSEDVSLPEVKL
GNDDDETETEIIEMDDSSQIVREVISDIIQNITENFECNSIKSVPADLDVSETFCCDSDD
TTLTPENDKITTPENCTNVKEETMNSNGLENPSSPSINDNNCCKETIEEEKGKIVDSAVT
VIDNLVQLSEKKNSDLPSNGEETLNENNCSNHNGSPKGEQQQQQSQQPEGMRKSEFMSSG
VTDTTSLTFEENVNFSENEVIIKSGYYGGGGGSGGGGYEECNKEEEEEKIQENIQERDFN
DGGERNLNSSTSTQVDPTQFEPYSKSGSRHMFSPGPTRPPFRIPEFKWSYIHQRLLSDVL
FSLETDIQVWRSHSTKSVLEFVNSGENAIFVVNTVHLISQLADNLIIACGGLLPLLASAT
SPNSELDVMEPTQGMPIEVAVSFLQRLVSMADMLIFASSLNFGELEAEKNMSSGGILRQC
LRLVCTCAVRNCLECKERIRKFSALPPLDSQSKIHSLIRGAQTTSKNLVDNVTTQSSPVK
DPDKLLQDMDVNRLRAVIYRDMEETKQAQFLSLAIVYFITVLMVSKYRDILEPPVSIRGE
PSPPPIPPAEESTSSENGSRPLFHQWSHHVYPQFLPGTHQHPSSFPPRPQPPRSNIVIKN
NTSRHIRPNHQVTNANKLGGCEEESEYEVIVVGENNPSVLADHETNAPAATNGPSSIRQL
PCNRQRSSAINHGCYEMESSLRPISQTDRNGEDIGEESRGCSSSSTRVEIERNSDMESNM
ENGSGKKSGNEDTWTDVNLNDDGDVNNKNVKNMSLNHVHGMDNMDGNMQGVVNERGEKPK
QEISVVRIPSEYHSSHSTSSPEDLAIKNLVDHLPIPTPSREASLTQKLETALGSVCPLLR
EIMIDFASFLSKTLVGSHGQELLMEGKGLTTFKNSTSVVELVMLLCSQEWQNSLQKHAGL
AFIELINEGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHADFETQCAQTLLERREEE
RMCDHLITAARRRDNVIASRLLEKIKNIMSNKYGAWGCMDSHVTKSVEFWKLDAWEDDAR
RRKRFVHNPLGSSHPEATLKAALEHGAPEDAILQAREEFHAQLAASRSQQQHIQSSDLMD
DSELLTDDRDLDADLAGPVNISTKAKLIAPGIVAPGVVSITTMELYFEVDEDDEEYKKIN
TEVSLLIYFLFYFIAFISIDSKILKDNLRSQVFKILRVDRRIYNTRWILKT
Download sequence
Identical sequences E0VB78
vb|PHUM055000-PA|EEB10634.1|conserved 121224.XP_002423372 XP_002423372.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]