SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM055020-PA|EEB10636.1|protein from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM055020-PA|EEB10636.1|protein
Domain Number 1 Region: 83-383
Classification Level Classification E-value
Superfamily BEACH domain 1.83e-127
Family BEACH domain 0.000000000231
Further Details:      
 
Domain Number 2 Region: 500-741
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.27e-32
Family WD40-repeat 0.0048
Further Details:      
 
Domain Number 3 Region: 17-78
Classification Level Classification E-value
Superfamily PH domain-like 6.76e-17
Family PreBEACH PH-like domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM055020-PA|EEB10636.1|protein
Sequence length 751
Comment FAN, putative|DS235023.1:344007:350669:1|gene:PHUM055020
Sequence
MSELKQASAYPLPGDVLKYCDHLHGKWYFSEIRAIFSRRYLLQNVAIEIFLASRTSIMFA
FSDQATVKKVIKVLPRVGVGIKYGIPQTRRASMMSPRQLMRNSNMTQRWQRREISNFEYL
MFLNTIAGRTYNDLNQYPVFPWVLTNYDSSDLDLSLPSNYRDLSKPVGALNPSRRAYFEE
RYNTWEHESIPPFHYGTHYSTAAFVLNWLIRIEPLTTMFLALQGGKFDHPNRLFSSISLT
WKNCQRDTSDVKELIPEFFFLPEMFVNNNRYRLGHQEDGSPVGDVELPPWASSPEEFVRI
NRMALESEFVSCQLHQWIDLIFGYRQKGPEAIRATNVFYYLTYEGNVELDSITDPVMKEA
VENQIRSFGQTPSQLLMEPHPPRSSAMHLSPMMFSAVPDDICMIMKFPSNSPIVHISANT
YPQLPLPAVVTVTAGQQFAVNRWNSNYSGSVQSPTYADSSQHSGSNLPLSMDPILSQTGN
TSTSTQRRHLGDNFSQKIKVRSNCFVTTVDSRFLVACGFWDNSFRVFSTETAKIVQIVFG
HYGVVTCLSRSECNITSDCYIASGSADCTVLLWHWNARTQTIVGEGELPTPRATLTGHDQ
PVSVVVISAELGLVVSGSVNGPVLVHTTFGDLLRSLEPPSGFNSPENIAMSREGVIVVNY
EKGQVVAFTINGKRLRHESHNDNLQCLLLSRDGEYLMTGGDKGIVEVWRTFSLALLYAFP
ACDAPVRSLALSHDQKFLLAGLSTVKKLSKK
Download sequence
Identical sequences E0VB80
vb|PHUM055020-PA|EEB10636.1|protein 121224.XP_002423374 XP_002423374.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]