SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM058250-PA|EEB10688.1|grb2-associated from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM058250-PA|EEB10688.1|grb2-associated
Domain Number 1 Region: 81-179
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-24
Family Pleckstrin-homology domain (PH domain) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM058250-PA|EEB10688.1|grb2-associated
Sequence length 191
Comment binder, gab, putative|DS235026.1:56238:57054:1|gene:PHUM058250
Sequence
MRKESDSGEFRNSRPISDYSGSEFDHQVNVKKREFKPAKLIQQRPLTRYLPIKSESLNLR
QHIESAGHQVDLCPHVFIDSTSCRGILHKLGGKFHHWNKRWFVFDRTKRTLTYYMDKTEK
KQRGGTYFQAIEEVYVDHLNSVKSPNPHVTFVIKTHERTYYLMAPNPEAMRIWVDVIFTG
AEGYQEFEHGS
Download sequence
Identical sequences E0VBD2
XP_002423426.1.24195 121224.XP_002423426 vb|PHUM058250-PA|EEB10688.1|grb2-associated

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]