SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM060700-PA|EEB10723.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM060700-PA|EEB10723.1|conserved
Domain Number 1 Region: 122-498
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.2e-140
Family Myotubularin-like phosphatases 0.000000022
Further Details:      
 
Domain Number 2 Region: 3-111
Classification Level Classification E-value
Superfamily PH domain-like 8.61e-16
Family GRAM domain 0.038
Further Details:      
 
Domain Number 3 Region: 633-684
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000187
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM060700-PA|EEB10723.1|conserved
Sequence length 689
Comment hypothetical protein|DS235030.1:90440:94079:1|gene:PHUM060700
Sequence
MEIIKTPKVENVKMLNKYNNNYSSGTLYLTATHLIFVGPDCKKETWILHNHIYNVEKLQL
TTSGSPLLIRCKTFLSVTFVIPKERDCYDVYIALSQLSKPASVNELYCFHYASSTEDIPK
SAGWNFFDLVSEYQRMRVPNDVWIATDLNINFELCETYPRYLCVPASASPGILKGSSNFR
SKGRLPVLSYLHKNKAVICRCSQPLSGFSGRCPKDESMLNSILKTNPNASYMYVVDTRPR
INAMANRATGKGYENETFYENIKFHFLGIENIHVMRSSLSKLIETCELKCSTMSNFIKGL
ESSGWLKHIQAILDTSLFIAQAVENGVSVVVHCSDGWDRTAQVCSVASLLLDPYYRTING
YQALIEKDWLAFGHKFSDRFGHLNGDSKEVSPILTQFIDATWQIWNAFPHSFQFNEKFLL
TIHDHATSCQFGTFLGNCEKERADLRVKEKTFSLWGYMANHVHEYVNPLYCADDNSEFLV
PNTASQNIKFWREMYCRFESGVHPREPIKEILHASADHSTALKDHINLLQCRIAQLEKLL
GHSKSNHEFNTLNKTSSTMKNLENDIKNSLKLNEPPSSPPLEKTAESKSDIDLKSFKNNN
IDVITPISSEILKNEMESVALEWKTFRNIVECSCMTPFDHSSRKSHCWKCGGLFCTRCID
KMITLPGLSLKRPVPVCRQCFNIVKEYSN
Download sequence
Identical sequences E0VBG7
XP_002423461.1.24195 121224.XP_002423461 vb|PHUM060700-PA|EEB10723.1|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]