SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM064260-PA|EEB10770.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM064260-PA|EEB10770.1|hypothetical
Domain Number 1 Region: 4-145
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.00000000000000255
Family BCR-homology GTPase activation domain (BH-domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM064260-PA|EEB10770.1|hypothetical
Sequence length 238
Comment protein Phum_PHUM064260|DS235032.1:125152:128591:1|gene:PHUM064260
Sequence
MEVIKDNLEVEGLFTTCGNLRTRKKIQTYLSRGDIYTLRNWGFEFVIECAAALKIFLQNL
PQPLIPMRIQQLVIAENIGVPEKTIAYDALGLLKEEVNGRHKELLLEVFTFLKEAAVRIN
TSELTGCNLPLKLLPVFFKIESADPRKFRDIATVFHEIIMEAPEHLKSPCRKIPSGELKM
LERFLSQDMRMPSVTLINPRSGRNQPTGENPEWRIPMPRVPQTRLHPWLGRVEHSTFV
Download sequence
Identical sequences E0VBL4
vb|PHUM064260-PA|EEB10770.1|hypothetical XP_002423508.1.24195 121224.XP_002423508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]