SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM064900-PA|EEB10775.1|Rho/RAC from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM064900-PA|EEB10775.1|Rho/RAC
Domain Number 1 Region: 410-622
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-34
Family DBL homology domain (DH-domain) 0.00046
Further Details:      
 
Domain Number 2 Region: 650-777
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000077
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Weak hits

Sequence:  vb|PHUM064900-PA|EEB10775.1|Rho/RAC
Domain Number - Region: 213-264
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.00912
Family NadC N-terminal domain-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM064900-PA|EEB10775.1|Rho/RAC
Sequence length 872
Comment guanine nucleotide exchange factor, putative|DS235033.1:39568:45272:1|gene:PHUM064900
Sequence
MNAITIFVDYFVFFFPLELEPEVGIEHLDDLKYPNADPPCHFCMQQTSTSIHDENRLKIV
SGGLVRKRDGSRDEAANHYMNLPSPIIHNESGDADSVFRPKQKMEDESNHIQNYFLEELK
ESQLPPPSALSRRRAIITSKLTTNDLDDHKLSWSSNFNTPRNRRSSIVVIPPMQICPGDL
LVYSKVLTNRQKTLDLESSSQCLNFDSEESRKGKNTWSLLKLFERSNRGKSGSIGGLEEV
LGCIQRAEFEDEELSYYRGLSWFEFYTRVNDRKRKPSRKKNPSDSTDRSEIKEDVSSPTD
SKEFPVVSKPTELLTFETMAQVETVSVSSEIQIPKSPTKSDKSATSDLTKSKKQETTVRK
LHRKLVRAQSERCFERSRLPSWRTKEKPVMSKPMPLVQTLSEKNLVSPVSTSSQGEYKRR
EAVWDLFQSECAFLFDHLMVLKNVFLEPLKRIQVEGFAMFAEPQLLFGNLDELCSLILEK
VGPNGELPTTEVLGELFQKNENADSVSQAYHCYVLNYINALNYLETLRTHTEFCEFEKWC
NKDERCKKLQLTDLLVAPVQHIMKVPLILKEVESRTEDLNEKIIITQILEIEEKSIRELD
DKMKWLKNFERLLEIQKNIVWPSVQELDPKIFVPDFLKPALQRQPCDRIIVSPRRQIIIE
GQLQILDSGKAQEVFVVLFDDMLLITKRKKGLSKKKSTLSENWASSCRSSSNPESSMRYV
VYKQPLSLDRFFVYDITLPESVSCRLEFAFVLVVMNRFQQIQNWLTKLKETQEKWKKTLE
NTMYRPSSPQDIRNPNGTAEISVNESMNSYFKNPSGTSFCTKSNISVFDDSTTDICSTID
RSSPLPESYPTRQSSGDDESHSFSFPVTKSFF
Download sequence
Identical sequences E0VBL9
121224.XP_002423513 vb|PHUM064900-PA|EEB10775.1|Rho/RAC XP_002423513.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]