SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM075760-PA|EEB10896.1|ECT2 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM075760-PA|EEB10896.1|ECT2
Domain Number 1 Region: 347-567
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.94e-54
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 52-177
Classification Level Classification E-value
Superfamily BRCT domain 4.93e-19
Family DNA ligase 0.04
Further Details:      
 
Domain Number 3 Region: 182-266
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000000901
Family DNA topoisomerase II binding protein 1, TopBP1 0.058
Further Details:      
 
Weak hits

Sequence:  vb|PHUM075760-PA|EEB10896.1|ECT2
Domain Number - Region: 559-676
Classification Level Classification E-value
Superfamily PH domain-like 0.0141
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM075760-PA|EEB10896.1|ECT2
Sequence length 808
Comment protein, putative|DS235044.1:80317:85389:-1|gene:PHUM075760
Sequence
MSKRICIVGSLGQDSSVFHAAQSFNVPIIFSETGEECVSDGESFTTYFIIDEFSGPCFDY
LCKMKCRILGPTALKELVNNGDPLPSTDKSRPVYCLSMKGLIICFTGFRKRTDLCHLASL
IHLMGGSIRKEMEYKITHLVANYPSGDKYQYASTFNIPVMSESWITSAWENRHVVAEHKL
KFGGAKVCFLGFNSEETEHMIQVLVENKGVPSSLDDPQCTHLVVDDANIGNFPDNAPPKA
FVVKAEWFWASVQNELCADEKEYLFEDFVNSVIGTPDGKRFQSTPLSGNVSSRTRKRKRL
QQKPPINHFESPLTHKRRSSISDAGLLSVSGSYLDCSETPDNNLYDDIKTSRDAERTISG
RHQVFLELVHTESNYVNILNTIISLFKIPLEEMLDGENVILNATELKIIFGNLPPIYEIH
LNMLEELKWGVQNWKEDFSVGNVILRYAPELEKAYPPFINYFEKSKEMLEQCDLMKPRFH
AFLKIRQAKPECGRQSLKELLIRPVQRLPSISLLLNDLIKQTDKQNPDQQALEQALAGIK
QAMTHINEDKRKTEAQLAMFDLFNDIDNCPAHLISSHRSLIAKCECVELTEILSSKKGDN
LVLLLFTDTLEVCKKRVRTFNTFRSTKPSSLQKINKFRKQYKHIRLMPLSNLRKVIDIRE
TEEYQRIFALLCRNSESLKENLCSFIITDEKLDKNFFLKEMCKQMAHTVCTTDPEDFYDV
MEPGDVNLETANNASTICKSTHSFSKALRFASKTGVKVSRALSMSKTPSKLTRVVSTLRP
FASQMTLTPNATSFLEQPLVSTAQAISQ
Download sequence
Identical sequences E0VBZ0
121224.XP_002423634 XP_002423634.1.24195 vb|PHUM075760-PA|EEB10896.1|ECT2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]