SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM075880-PA|EEB10898.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM075880-PA|EEB10898.1|conserved
Domain Number 1 Region: 122-507
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.3e-121
Family Myotubularin-like phosphatases 0.000000261
Further Details:      
 
Domain Number 2 Region: 9-117
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000861
Family GRAM domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM075880-PA|EEB10898.1|conserved
Sequence length 555
Comment hypothetical protein|DS235044.1:91814:94491:-1|gene:PHUM075880
Sequence
MEFAEYILTSKVNKVAITIPPNTELEAVICITGHHLIISSRKDGAEEIWLLHSNIDFIDR
RQANNVQNGGSLFIKCKDLRILKMDLFNQKDFVNVAVTLDRLINIEDISKLYPFFYRPNF
MVIENGWDAFDTESEYKKLVSTCPDEWRFTNVNKEFQVCGTYPKILIVPKIIDDETVVAA
ASFREGGRFPILSYRHKTGSILMRSSQPLTGPNSKRSKEDEKLLNSLLGPGKRGYIIDTR
ALNLAQNAKSKGGGFEHEMFYPLWKRIHRSIDRYQTLLDSLTKLVEACNDPSCPMDRWLS
RLDSSNWLTNVKETLNCACLAAQCLDQENSSVLVHGQDGLDSTLLITSLVQVILNPDCRT
IRGMEALIEREWLQAGHPFFLRHKKFCFAPPSSKNKIVAPTFLLFLDCICQIHCQFPCSF
EFNQNFLISLFEHSYSSQFGTFLGNCEADREHLKLREQTTSLWSYLNQPEILRSYLNLMY
EPNNSVIWPSVAPVSLGLWSELFFRWIFDFSSQNSAFESMANIKTQELELIKQAKRLRRR
VAELEREAIETGVLN
Download sequence
Identical sequences E0VBZ2
121224.XP_002423636 vb|PHUM075880-PA|EEB10898.1|conserved XP_002423636.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]