SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM076550-PA|EEB10915.1|transcription from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM076550-PA|EEB10915.1|transcription
Domain Number 1 Region: 14-78
Classification Level Classification E-value
Superfamily Histone-fold 1.03e-17
Family TBP-associated factors, TAFs 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM076550-PA|EEB10915.1|transcription
Sequence length 246
Comment initiation factor TFIID subunit, putative|DS235044.1:196301:197523:-1|gene:PHUM076550
Sequence
MSNNNSTQSKNVPKDAQVIMSILKDMGVSDFEPQTIIQLLEFTYRYITTTLEDARVYATH
ANKKIIDLEDVQLAVHMQLDKNFTTPPPRDMLLEIARTKNSLPLPQIRPHCGIRLPPDRY
CMTACNYELRSNKKPAGNLKSNTIYSNAQSSVFKPQIKSGIKRSIQTITRTQTITIPKPI
IKFTTSSNISPSETTGQSQQSPIQPQTTRVQQQWKPIIQQPVVQTVVELDEPPASLIKKS
SISDDI
Download sequence
Identical sequences E0VC09
vb|PHUM076550-PA|EEB10915.1|transcription XP_002423653.1.24195 121224.XP_002423653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]