SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM076930-PA|EEB10923.1|fam43 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM076930-PA|EEB10923.1|fam43
Domain Number 1 Region: 2-144
Classification Level Classification E-value
Superfamily PH domain-like 1.76e-19
Family Phosphotyrosine-binding domain (PTB) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM076930-PA|EEB10923.1|fam43
Sequence length 426
Comment putative|DS235044.1:254883:257487:-1|gene:PHUM076930
Sequence
MWKRGSATITAEDPTYKVSYLGNVLTGLAKGEGCIEKPLNTLWKNYNESLKPSIQMKIKV
TQSGLKAVTKDHGLIEYWSHRITFCTVPPEFPNIFCWIYRHEGRKLKQELRCHAVLCSKE
SVASKMSDTLKTRLTQALVEFKRDKLLRQNARLSLVNSVYDNPSLPKRKILLSTGCHNYK
PPIERSKSAPKLMKVSDDGNKSDYKLANLSFVKKLCSSIENLVESTSNYSRKFFTERKSN
RETSYVTIKNSDESGKKLDNNSISEINLKSSKMNVNNEGCNIDDFKSKFIQNLSSSNCRI
TSDKKDIFFTSDNNSNPVVVTSVKNFNGNTIERLPNYLSTGKSLPEGKIVVFNCDCQDSQ
DSSPPLVNNGQEVVVSLDDDDDDNNKCVQLTDDLLVQKLTSLDVPYHKIIKSTALSEIKK
WQINKF
Download sequence
Identical sequences E0VC17
XP_002423661.1.24195 vb|PHUM076930-PA|EEB10923.1|fam43 121224.XP_002423661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]