SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM076940-PA|EEB10924.1|FERM from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM076940-PA|EEB10924.1|FERM
Domain Number 1 Region: 513-728
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-39
Family DBL homology domain (DH-domain) 0.0006
Further Details:      
 
Domain Number 2 Region: 218-360
Classification Level Classification E-value
Superfamily PH domain-like 7.68e-35
Family Third domain of FERM 0.00046
Further Details:      
 
Domain Number 3 Region: 114-220
Classification Level Classification E-value
Superfamily Second domain of FERM 3.79e-31
Family Second domain of FERM 0.0000615
Further Details:      
 
Domain Number 4 Region: 718-855
Classification Level Classification E-value
Superfamily PH domain-like 3.6e-26
Family Pleckstrin-homology domain (PH domain) 0.0062
Further Details:      
 
Domain Number 5 Region: 29-114
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.53e-22
Family First domain of FERM 0.0037
Further Details:      
 
Domain Number 6 Region: 875-987
Classification Level Classification E-value
Superfamily PH domain-like 9.44e-20
Family Pleckstrin-homology domain (PH domain) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM076940-PA|EEB10924.1|FERM
Sequence length 998
Comment RhoGEF and pleckstrin domain-containing protein, putative|DS235044.1:261899:278633:-1|gene:PHUM076940
Sequence
MDSGKITHSQSQPGGIDRTPPGTPKKGGKMLAIRVQMLDDTVTLFQIQAKALARVLFDQV
CSQLHLLESDYFGLEYQEMNGTKYWLDLEKPLSRQVGLSLVDTMVKFCVKFYTPDPSQLE
EEFTRYLFCLQIKRDLSQGLLQCNGNTAALMASYIVQAECGDYVAEDYPDYRYLSTYKFM
PNQDQELEKRIMENHKKHAGQSPAEADLNLLETARRCELYGIKMHPAKDHEGVPLNLAVA
HMGIVVFQNFTKINTFSWAKIRKISFKRRRFLVKLHPEGYGYYKDTVEFFFEGRNECKNF
WKKCVENHGFFRCSVVKKVPRHKTRVLSRGSSFSGRTQKQIVDFVRENYVKRQTFQSHDS
YELLEKELDVFNNESGVEEKPKEDDSEICRARSYSWGSDKCLLEQGPLYSNIDPAYVRFR
DNGFRSLEREKNTKYYNDGDFRSLDRNTFKKLSNRDNKESKIVSGALKHTIDGSENFDGT
HLVTNKVICKNAKNGRSGITPKNKLNESESKKKRYNADKGYFMIKELLSTERTYKKNLEV
INKWFHDEVSKSEDDMPDDVLNGLFNLFDPLNIAHSQFLKDLEHRMATWEGKSNNIPKRE
IQQIGELILNHFNILPLYVKYLDKHLLILERLDAAFRKNKKFEILYRDFELQRVCYLPLS
SFIMKPLQKLIHYNSLLQRMIMHYGPDYSDYKDFSIAQKKLQPVLENISTVLRVSENFVQ
LSELQRDMPSFEGLLQGGREFIRQGCLLKHSKKGFQQRMFFLFSDILVYSNRCTTPSLQF
KVNGQMPLRGVMIEQSDDKMGTNFTFTIYGGNRTLIVAASSQEEKERWLEDLYEAVQNAR
EKNDGKTLKYLSLKSCSSSDEVIDKVDDEGNLNRNNKNSQQRSNTTVHVCWHRNTSTSIG
DHLKSYENELSGFLLRKFKNSNGWQKLWDESPLASLPLLGYSITIPEEEDEIKKDYVFKL
QFKNHVYFFRAESDYTFSRWMEVIRSSTKNTFNNVNNY
Download sequence
Identical sequences E0VC18
vb|PHUM076940-PA|EEB10924.1|FERM 121224.XP_002423662 XP_002423662.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]