SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM077880-PA|EEB10932.1|Vasodilator-stimulated from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM077880-PA|EEB10932.1|Vasodilator-stimulated
Domain Number 1 Region: 1-99
Classification Level Classification E-value
Superfamily PH domain-like 1.04e-33
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000175
Further Details:      
 
Domain Number 2 Region: 404-434
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0000000353
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0032
Further Details:      
 
Weak hits

Sequence:  vb|PHUM077880-PA|EEB10932.1|Vasodilator-stimulated
Domain Number - Region: 235-242
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0288
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM077880-PA|EEB10932.1|Vasodilator-stimulated
Sequence length 449
Comment phosphoprotein, putative|DS235045.1:194857:197968:1|gene:PHUM077880
Sequence
MIYDDTTKKWIPSGTSSGLSKVQIYHHTVNNTFRVVGRKLHDHEVVINCAISKGLKYNQA
TATFHQWRDSKQVYGLNFSSKEDADAFAKAMFLSLDTLSNIINRMPAAAPAPVISINQQV
YYTNAYNVNGQTNEEEVEYSRMNQRDEVPCMERRVSQAQLIESPNAAVGSQGSQGHHRTS
SAPPAPQPPQLTPLASPCQPVGAPPAPPAPPVWGGGGGGINNVPSVQPAQVQSAPPPPPP
PPNMPRSSSSDGHDSNSLAAQIQSARLRRINNNGSNTLGSTTKQSAENSGSSTSSGGSNY
GTLGRGGMGSMASMMDEMAKTLARRRAAAEKKDLNDEETGNSHQEKKVINENKVDIKLTN
FGSSTGDESPKSIKKKFGPDATSDEYSNKANVNGLCEELNNVGISSQDLELFKQEILKEI
RREFQKMKMEIIDGSGSLVAHAGVLSQPR
Download sequence
Identical sequences E0VC26
121224.XP_002423670 XP_002423670.1.24195 vb|PHUM077880-PA|EEB10932.1|Vasodilator-stimulated

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]