SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM080450-PA|EEB10981.1|eye-specific from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM080450-PA|EEB10981.1|eye-specific
Domain Number 1 Region: 149-464
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-94
Family Protein kinases, catalytic subunit 0.0000000572
Further Details:      
 
Domain Number 2 Region: 16-117
Classification Level Classification E-value
Superfamily PX domain 5.63e-24
Family PX domain 0.0000911
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM080450-PA|EEB10981.1|eye-specific
Sequence length 494
Comment protein kinase C, putative|DS235048.1:111660:114881:-1|gene:PHUM080450
Sequence
MSSDVVEKVQTARVQDSETWDIEKRSKYTVYKVVVHSGSSSWFVFRRYAEFHKLFESLRK
QFPNLQLKLPGKKLFGNNLDPNFVAMRQDGLDNFVQQIISHTILLQLNKFRLVLTYNKCS
AIDEGITKDENILVNDDNKTEINKLNLGPSERTHAQPSDFDFLRVIGQGSFGKVILAKHK
NENKYYAVKVLKKKQVIRKNEAKHIMSERNVLLKTLNHPFLVGLHYSFQTTEKLYFVLDY
VNGGELFFHLQRERVFSESRSQFYAAEISCALGYLHFKGIIYRDLKPENILLDAQGHIVL
TDFGLSKEGLLGTDTTKTFCGTPEYLAPEIILKEAYDRSVDWWCLGTVLYEMLFGLPPFY
CRDTSEMYDRILNKPLVIKTTVSEGARDILSKLLEKDRSKRLGSGYGDFDDVQRHPFFRN
INWDSLVGKKIKPPFNPLVRGVMDLRNIDPQFTKEQVPASIEQNCDEYLSASVREADDVF
AGFSYAPPTAELSA
Download sequence
Identical sequences E0VC75
vb|PHUM080450-PA|EEB10981.1|eye-specific XP_002423719.1.24195 121224.XP_002423719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]