SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM083370-PA|EEB11014.1|RNA from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM083370-PA|EEB11014.1|RNA
Domain Number 1 Region: 126-214
Classification Level Classification E-value
Superfamily Prefoldin 1.91e-16
Family Prefoldin 0.0038
Further Details:      
 
Domain Number 2 Region: 18-97
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000619
Family N-acetyl transferase, NAT 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM083370-PA|EEB11014.1|RNA
Sequence length 508
Comment polymerase II subunit 5-mediating protein, putative|DS235051.1:183015:185566:-1|gene:PHUM083370
Sequence
MPNGPKIDAKEKDGFLTEPPLFNLLVAHIPGDDKLIGYALYYNKYSTWTGKAMVLEDLYS
IDTGCQQLDFEVLSWNPATKFYKYFGAQNITEKDSWHMYRIGEVNQWYESLRNQKLDQND
KTSVIWCKYKTDLETTKSLLSILPKKISHDVMVPIGPKALMRGKLVHTNEYLVNLGETWF
VKKTAHQTLELCNRRIKNCNEMIQKLEKEKELILNKTILPEEEDAFGNAERPEIIEYVTE
EENEEWNKQHRLKEKEYRLKLAELRNKEKKTIDTEEDLWKHLDELELREELEDELNRLNE
DYSSSDDDIENDSLEDGGDENDSKVISVNKNSTRNDTVNKPESINDCFDETIENNINNNN
NSNTASNSNSNKKRKVSFACDINSSDEEPLRLEIKFSNVEPIKNLKNNSEINSPSDIYDN
YSGLLKTSQTSVLKNSFNPNKEKELEKVKKLKSYYDSESEGEECSIHSTSTIVFNDVAER
NSFDDSSTVKKFESNNKKISKFKASRKN
Download sequence
Identical sequences E0VC92
121224.XP_002423752 XP_002423752.1.24195 vb|PHUM083370-PA|EEB11014.1|RNA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]