SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM086680-PA|EEB11056.1|TFIIH from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM086680-PA|EEB11056.1|TFIIH
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily PH domain-like 1.97e-30
Family TFIIH domain 0.0000375
Further Details:      
 
Domain Number 2 Region: 107-149
Classification Level Classification E-value
Superfamily BSD domain-like 0.0000000000523
Family BSD domain 0.00056
Further Details:      
 
Domain Number 3 Region: 181-233
Classification Level Classification E-value
Superfamily BSD domain-like 0.000000379
Family BSD domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM086680-PA|EEB11056.1|TFIIH
Sequence length 560
Comment basal transcription factor complex subunit, putative|DS235053.1:196263:198904:1|gene:PHUM086680
Sequence
MTTSSEDVLLQVNQVRYKKGDGTLYVMNERLAWMMDNRDTVSVSHKYADIKMQKISPEGK
TKIQLQVVLHDGSASTFQFTNRLGLQAQIKDRDDVKELLVQLLPKFKRKIDKELEEKNRL
LSENPSLLQLYRDLVITQVITSQQFWNEHAVKYTSKMNMQKQEIGVNGAFLADIKPQTDG
CNGLKYNLTADVIQSIFKTYPAVKHKHLEYVPHKLSEAEFWTKFFQSHYFHRDRINAGNK
DVFTECARVDDEELKKELDNGVPDVLCNISEFEDKTLDEGYGTGTSTASVQASSGNIVHQ
NMIKRFNQHSIMVLKASEKKNDESNGAFTTSDGMVAVGSAPVPKKSDIPNGSAEEPKSKK
SRLQEKIVFDDLVSQGEENDAAPKLQLSQCNDNYLIERYLNCPMQIANLDISTDYFSVCS
KMAKESENWLVQKKQSTPVLVSPANAVSALGELTPGGALMKGFQEESLAQLVPKELEKEL
KHTYNALCELLRHFWSCFPPTTKTLEEKASNVHESLHRFELAKLKPFEFNPLSQHLTRHV
NEMLQFAYRKYNTWQQRMHR
Download sequence
Identical sequences E0VCF0
121224.XP_002423794 XP_002423794.1.24195 vb|PHUM086680-PA|EEB11056.1|TFIIH

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]