SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM087100-PA|EEB11078.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM087100-PA|EEB11078.1|hypothetical
Domain Number 1 Region: 796-993
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.59e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM087100-PA|EEB11078.1|hypothetical
Sequence length 1529
Comment protein Phum_PHUM087100|DS235053.1:400341:406307:1|gene:PHUM087100
Sequence
METTRFRQSNNNKITVNRSALKTTNFDIVSNMGKPKVETSPLVLKEKKTKRERWLLTRKT
WRYMTDAGRKLIPDGVHNRQEDIPKIEAYFQEVCQREPKFLLWRKSSYPGALGLRTHGRR
TRPRIKGGSVREKASSADEAEDIKRFGKNPSTGKMLMTPAGTGRFDLMKLSEHKQEAEDE
LITELENFLRVNDESTLKKKLNHEELFDKLQKYLEEVQSMQKQLNHKTYGEIIPEPSQRE
LLNTLKRHYRKSTNREAVISNLLTDRKMLEKLYFDLRKTRGFRSGNVYRPERGSGGFATK
DTNRDLLTIDKKNFHVNVQDISKGMDDMSLSSPSETITPTVAEDEEVILKITKSIQTLKI
HPDMMKAIEEKLKKIEEESVKSNVKEQQPNKTPKTRRSSLDHDDVSPSVGDTIKRYLKMA
RKKSVDSDKKDRFKTINYDENLRNIKPKESADGIGNDDGLDKGCQSGESWIKALKDFKMD
DSWMAYDDCKEVITVCETKEYKIKHGGDSLTSSAGPHPKTGLLSSGQLFLSNLFHGLQHT
TDKNTVLPTAMQKSKSSTSVGRNLVSKKIWRGRSKSQSRLSTTQPCSWTPLGNCVWSNLV
GKQVTLTETNIFQLSEIERRILQKVALAKLQALNIGCNIQIPSEVATPAIETKTKRRPHL
LKRKAITTSFFDTNRGKDKEPTNPTNTGTTTGGMVFGVPLSQCIENERLTRNSSCSNVMM
SFKNKNLTFPYDSDTELKKKTYHGSRTSFSSLIEPRPQDESAGSTDSLGSSSVPGLLDAI
SIGSTANISLNTAENEPIVPNIVSSCLRHIENHGLHTLGIFRVSSSKKRVRQLRESFDSG
KEICLDEYCPHDVATLLKEYFRDLPDPLLCKDLYQAFVLTQKLRNRKLQFEALQHLIQLL
PVSNRDTLWSLLNFLSLIATNSDDRKNHLGEIVPGNKMDSNNLATLFAPNILHRRTAGAV
TKESLSAESCEERIDVINVIRSMIDHNKSLFQVSPEMMDEIYLHMMDNNSEALDQLLSKK
ETADETLDDQDSEALEEIGTGSDSSSLPQSPKTFNETTTDPTVDKEKKIYSREQFLHEKS
AFELFDMDTGFRTRERDRSKTGLIRRNRRESNSKLWTTDYQSSEMKSSDDEHNSSAILES
SGILKASLTIPTSSFALNLDDSDIPFIEDNNNLTEGSKHQLSFSTMRNKSSVSYSSSSSR
YKSTNESDTTLIPVSVQAVTSSFPFSQGASGNEVLSCLGYDSAVGSSGTFSSPPRHTATS
SLCSSSNDRECFSSPPSWGSSPPLSPQSQTSTIDDQSDDISISTIGRICIPAKALTDSMQ
TNLSEKDDLDDDFVRTSMLKNQKKTEKIKLKDVVSKTLEVQKNKEENDKKYETSNKSVTK
DLYQRVHSLVGGTSSLPVTETLTKSASSSQLSKKVEIESDSGDLNRKVTTSITNIGGAVM
RSKTADIERMLKIKPDVKKTKGKSETKITTTKIDAEKKYSKRRYTDSRHPTKQIPDMSEK
SLTTQTTPKTQSIWKRREIISSSPKGGEG
Download sequence
Identical sequences E0VCH2
121224.XP_002423816 vb|PHUM087100-PA|EEB11078.1|hypothetical XP_002423816.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]