SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM097020-PA|EEB11184.1|hspc200 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM097020-PA|EEB11184.1|hspc200
Domain Number 1 Region: 463-609
Classification Level Classification E-value
Superfamily PH domain-like 2.73e-41
Family Phosphotyrosine-binding domain (PTB) 0.0026
Further Details:      
 
Domain Number 2 Region: 286-343
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000053
Family SAM (sterile alpha motif) domain 0.0045
Further Details:      
 
Domain Number 3 Region: 176-235
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000922
Family SAM (sterile alpha motif) domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM097020-PA|EEB11184.1|hspc200
Sequence length 704
Comment putative|DS235063.1:331209:337435:-1|gene:PHUM097020
Sequence
MTSGGVNFLISFSLHRFVRLSKLFKLKPKNNRQLISVPIMNASLTITEAVASLYKGSTSQ
LMDSSHRVTPAERPKTLRKLKNVYENVTKEGNGGCATGNDEGTRCSLVSSTTDKSLSILS
PFDEQEEWAKISEIMASFSSGLVRDSIFVAEMEKEIQSRLGLSSQKKSEDVSKVLTKVGQ
WLSTMNLERYEKNFLDHGYDDVDFLNGLLDKEELKNIGLTEEEEVAIVLKELNNLNCKIK
DIKKQFSVNNFDDGGGKESEESENNEEGEEEEGKRGEEEENGEKKFEMISNWLDSINLGI
YKETFKRHSYLDMERIRKIWEMELTSVLEITKRGHRKRILASVGGGSPYKTDVLFSSSRT
SGPNLDELSADLSQLKSNIQQLKEEIREKLPGGNACTNVTATQNSLPLLTVPNSGGTLRH
SHKKNKPAPPPPTAIGDGGTTPAKSNVTPNLPIRNPSELLVGVPSTLTTQWRHRPEELVT
GNITYVANYLGSTVVKELKGTESTKKSIQKLKKTSKELTATPDIMLAISYRGVKFLNTGT
QELVCEHEIRNIHCACQDADDLTHFAYITKDHISRSHYCHVFCVETMDQATEVILTLGQA
FEVAYQITLREQISGNRRGNGHTRSQSANQIVGSGVVTSNNTVGSGGGTITTTTTTTGNN
HSQLPNHSRSLSVNEMKMPGDCLKSKVEEKKIEERDGVVAVDDL
Download sequence
Identical sequences E0VCS8
121224.XP_002423922 XP_002423922.1.24195 vb|PHUM097020-PA|EEB11184.1|hspc200

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]