SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM104930-PA|EEB11285.1|N-chimaerin from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM104930-PA|EEB11285.1|N-chimaerin
Domain Number 1 Region: 267-436
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.0000032
Further Details:      
 
Domain Number 2 Region: 43-166
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-19
Family SH2 domain 0.000069
Further Details:      
 
Domain Number 3 Region: 188-261
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.14e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM104930-PA|EEB11285.1|N-chimaerin
Sequence length 451
Comment putative|DS235070.1:197827:199629:-1|gene:PHUM104930
Sequence
MTYINFKNNFFPVKTIFIPDKYFLFIFFFLGTTLCDNNLSKNVWKPDLYKLQQEAPQPLK
IEPQQYVIPRSEFCDNDYHGPLSNAEAVKMLTKEGQYLVRKSSSSCDKFFTLSLRFNNKV
HNYKLFYEKGNFFVKKERLFQTVYDLVADGLVTLYIELHAGKYISVMHGECNYESSPHFT
LNRMKREKTVPPVVEKVKNSLNEEICKNHSFKVHNFKGLNWCEFCGNFLWGFTAQGVKCE
DCGFIAHNKCSEKVPKDCCPDLKQSRGVFGIDLETLAKSHQTLRPFVIDKCIQEIERRGV
NVEGLYRVSGFSEEVESLKMAFDKDGEKADLSPAVYDNIHVLTGALKLYLRLLPIPLVTY
DIHPILIKALKQSSESEEIKTIRNALNMLPPAHYETLKYLIKHLHKVVERHEFTKMTTLN
MATVFAPTLMPVPDLSKGIPSVVNEITTLEK
Download sequence
Identical sequences E0VD29
XP_002424023.1.24195 121224.XP_002424023 vb|PHUM104930-PA|EEB11285.1|N-chimaerin

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]