SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM106840-PA|EEB11347.1|popeye from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM106840-PA|EEB11347.1|popeye
Domain Number 1 Region: 10-87
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.0000201
Family cAMP-binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM106840-PA|EEB11347.1|popeye
Sequence length 104
Comment domain containing protein, putative|DS235072.1:199585:201783:-1|gene:PHUM106840
Sequence
MPSIIIFNLIKLLVVSQNGRALHIVFPHQFLDSPEWFGVPTDEFFQVSITAMEESRVLIW
HRDKLKLSIITDQFLQAVFDHILGRDVVKKLMQFEPFQRKNYSL
Download sequence
Identical sequences E0VD91
XP_002424085.1.24195 121224.XP_002424085 vb|PHUM106840-PA|EEB11347.1|popeye

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]