SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM111080-PA|EEB11381.1|transitional from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM111080-PA|EEB11381.1|transitional
Domain Number 1 Region: 438-711
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.57e-62
Family Extended AAA-ATPase domain 0.000000651
Further Details:      
 
Domain Number 2 Region: 205-402
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.65e-20
Family Extended AAA-ATPase domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM111080-PA|EEB11381.1|transitional
Sequence length 717
Comment endoplasmic reticulum ATPase, putative|DS235073.1:233617:236335:1|gene:PHUM111080
Sequence
MSWIKILKSVNKDESAKQNEESDSSWKILMPPVSNAINNCNKNTDYYVQCLCLSTILDDF
ILYVTDEKLFNVSKMNNNEFFELVKDVKVEKLEKYFYPEIAKSIFVSEITSAYDLPPEDA
EYILTKHFEKPRLIIKIPENSENQVYYVMKDYSNLYSNPSVHGFLPQINEKFVEPNMYKQ
GLTLSICPSGLMKHFKYLKTIFKPFLLKKKIQLKPMFLLSGAKGSGKKTTLEALALSLGL
HLIHANCFDFSGQNLTFISGKFDQIFSKVRRTVPCILHLQNIEFLGRDANYQENVRLIDI
FEREIKELWERKSFLYPVFIVASTTLAETDLVPSTARYFIDTIKFEVLKFEETYPTLKWL
IFSKNMNCSSDDLVKVAEKIKGYVFADLALLVDHAIRIKTQECDFSEFSNKLLPRHFEKA
FALMDDAYSHFIGAARVPTVKWEDIGGLADLKEEIMLTLNLPLKHPELFTSDLRRSGVLF
YGPPGTGKTLLAKAIATECNYTFLSVKGPELMNMYVGQSEKNVREVFDKARDAAPCIIFF
DELDSLAPRRGKSGDSGGVTDRVVSQMLAEMDGLDDNKDVFILAATNRPDLVDPALLRPG
RFDKMFYVGICTDETSKINVLKALTRKFSLTEDVNFNEIVKLLPKDITGADLYSVVSNAW
YASAKRYVDAIEIGENPSLPVFVNSEDFREAIEQFIPSLTDEDIDYYENFKTSENSY
Download sequence
Identical sequences E0VDC5
vb|PHUM111080-PA|EEB11381.1|transitional XP_002424119.1.24195 121224.XP_002424119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]