SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM117310-PA|EEB11445.1|DNA from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM117310-PA|EEB11445.1|DNA
Domain Number 1 Region: 71-187
Classification Level Classification E-value
Superfamily Histone-fold 1.09e-21
Family TBP-associated factors, TAFs 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM117310-PA|EEB11445.1|DNA
Sequence length 192
Comment polymerase epsilon subunit, putative|DS235078.1:161424:162092:-1|gene:PHUM117310
Sequence
MESFDTLHETETDMNLEVNVLSDNDGGNGDEGNNDDNNEELVNEYKAEGDEVYDDNENDD
YEDEYDNDNEDEDNEDDDENNFNEDEDEFDGDLDVSSAVNITHPDSEDLSEKLLRLPVNR
IKKLMKIDPDVSLASKEAVFLITKATELLINSLAKEAYTYTVEENKKTVMRKHLDAAISN
IDALAFLEGTLD
Download sequence
Identical sequences E0VDI9
XP_002424183.1.24195 vb|PHUM117310-PA|EEB11445.1|DNA 121224.XP_002424183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]