SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM118390-PA|EEB11463.1|predicted from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM118390-PA|EEB11463.1|predicted
Domain Number 1 Region: 392-640
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-71
Family Protein kinases, catalytic subunit 0.0000000827
Further Details:      
 
Domain Number 2 Region: 9-161
Classification Level Classification E-value
Superfamily PH domain-like 5.25e-38
Family Pleckstrin-homology domain (PH domain) 0.00045
Further Details:      
 
Domain Number 3 Region: 260-430
Classification Level Classification E-value
Superfamily SH2 domain 1.8e-30
Family SH2 domain 0.00012
Further Details:      
 
Domain Number 4 Region: 205-285
Classification Level Classification E-value
Superfamily SH3-domain 2.72e-16
Family SH3-domain 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM118390-PA|EEB11463.1|predicted
Sequence length 644
Comment protein|DS235078.1:286095:290840:-1|gene:PHUM118390
Sequence
MAGKDGKEEIVKEGFMVKRSQNKKRFTPVNYKQRWFVLTKNYLIYYDGDGDRKKEKGRVL
LTGVHVIESAKLSSNGEVNTLSDTHPQGYPFQVGYQENDQKYILYLLAEKDQDRIDWIQS
IRRVCLDNSLKSERYHRGVWSGKRWSCCRLSNRSASGCNICSSWSRAALTTLLRQSSTES
LVKNSPTKVEELESFVSKSSLNCNSIMPGGAPGTPSSKNKIPEKIMLRPKVVVALYPFKA
IEGGNLSLDKGAEYEVVDDSQEHWWKVKNASGVIGYIPSNYVKEKELLGLQKYEWYVGDM
SRQRAESLLKQEDKEGCFVVRNSSTKGLYTLSLYTKVPHPHVKHYHIKQSARGDFFLSEK
HCCGSIPDLVNYHRHNSGGLASRLKTSPCDRPVPATAGLSHDKWEISPTELMLQEELGSG
QFGVVRRGKWRGSIDVAVKMMKEGTMSEDDFIAEAKVMTKLQHQNLVQLYGVCSKHRPIY
IVTEYMRHGSLLNYLRRHEQTLGANVGLLLDMCIQVCKGMAYLERHNYIHRDLAARNCLV
GSENVVKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVLMWE
VFTCGKMPYGRLKNTEVVERVQRGVILERPKICLKEVYDVSLIF
Download sequence
Identical sequences E0VDK7
121224.XP_002424201 vb|PHUM118390-PA|EEB11463.1|predicted XP_002424201.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]