SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM119970-PA|EEB11474.1|voltage-activated from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM119970-PA|EEB11474.1|voltage-activated
Domain Number 1 Region: 357-542
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.49e-42
Family cAMP-binding domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM119970-PA|EEB11474.1|voltage-activated
Sequence length 558
Comment ion channel, putative|DS235082.1:2230:3906:-1|gene:PHUM119970
Sequence
MKDYTCVYTRHDCELRKKQLSEMTKKEKFKDSIIQRIFLASQFNYQSLHYLRSKGAVQLE
INRQKFSSHWYIFHPFSMGRFVWQIFMFFIFMVSVYYCPIRAAFFNSLMAKYLLMKNKNA
THIMKTLWINVLLDIIWLINSFGYFITGYYDESTDKVILNPKTIAKRYLSTGFFIDITTS
IPLEATVAFIFGLKAYSEMNHNLFIFLHVYNIYSNLRYHRHVVFCYKNRNASILSNLSLR
LLASIIVYTIIIIYTVYFNLIFPQMIYGTKLFLRRAQATLSWVQVGEIYHKDFLNQLKYS
VSKAVQGYVGATDWEEIIDLVDYILAILFSNLGRFCTVYCVIWFLQCITAANVLRTKFNL
ITDQLKTYMKQKEIPIYMKKRLNRFYFYRFQSHYFRGRALLDKLPKSLRKEISMYTCQKL
LHSTEVFQSVPKKILTRFTRKMYREMYFPQDVIVRANTYGESMYFICSGTVSVSTSNDVQ
IMLLHDGDFFGEIALISDNRRRIATVTAVTITELYRLEEFDYKKIIQSYPDVFNRLEKIA
IARFKMLLTVEKSIIEDS
Download sequence
Identical sequences E0VDL8
XP_002424212.1.24195 vb|PHUM119970-PA|EEB11474.1|voltage-activated 121224.XP_002424212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]