SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM125060-PA|EEB11535.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM125060-PA|EEB11535.1|hypothetical
Domain Number 1 Region: 1142-1225
Classification Level Classification E-value
Superfamily PDZ domain-like 3.29e-20
Family PDZ domain 0.013
Further Details:      
 
Domain Number 2 Region: 1344-1454
Classification Level Classification E-value
Superfamily PH domain-like 4.72e-20
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 
Domain Number 3 Region: 1234-1332
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-19
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM125060-PA|EEB11535.1|hypothetical
Sequence length 1458
Comment protein Phum_PHUM125060|DS235088.1:12336:19340:-1|gene:PHUM125060
Sequence
MNSSYGGGKLVGRGGADLVEYESEDERTSRRNRSQRGTPYSKIDIREQYCINNKEVQVLE
SGSSSLFGCLSKHNNGSCKSRQYFLSGCVSRVPSEENLHEFKFQPLPRRPIDDLERAYLR
RRPKSLCGSDSGRCSNWIPEEEEEEENLTTPKVLKKTAMKTQATQTGCIRREPPKYLSLS
PRTVHRVKMVSQGAQTNGQLTNGRKLMKSYSEAGCCFGEGHVGTTSCGRTKEHDTLVRTQ
SEEPRSPFSSMKTVLPWTENDNFINLNKSDVKKTTQNSTKIYKEIFIDFEPVEDLEMPKT
NNNNNLNDENIIKDDKESDKCITNHIVDRVDGIKVCQNEKDGSEKKSGASTPDIRDFQST
TLNVSKKISPFASCDSLGTDQKDHSDGIWNESQSTVLQAEIDNNDVTSRAPSKKHLLILQ
HQQRSSIDTEILENDTFYSQSPIRSPLKHDLAVPFVTVAPVHENHSIQLLSEVQLARNSC
HPPFASNAIHHNSRELRKKMSKSPEKEDFKFESGRITDISENSTTDDYATAYDNSDTSSK
VSVNYHQRDKMLGNKIESKDGSSFESASSIHSFVKEDTLQIVPSSPPTIREENSEEEILK
NALTDSGRFGDEEILKIDDKQDGNEKELSGEAESSSSGSYSLDSGQRDQKIEWPEQETLN
NNYDNLTEFKLEFSETHHNFTKWLDRPEITTTTTTTTTTTTTTSTLAGAAGATNDLTQKS
QHGATTDDVISGSSTKTNQSKKKMGKDNEEVPPKMVRSPAMPEGFSSDNWKSQTKIIHHI
GEKVQKGETEISSDESSSEYKNAIVDETNVNGHSPRRQRRKIGGRGRRNQIAIEGNSKKK
SLANTIPGNPELNLSPNKFGQSPVHSSKGSPRKVAKMTKGQDHKKNAPGSDGVTHLKTLS
AESLRSVSPGSDSVFYNEAETHMLCHQCGREYEGDHVRMEMEEITTTTTTTTTTTITTED
IVQPPAGFADSPENTKSRTHRLYKKQEKRFRSEERGGEKRRHSRFRAENLRAKSEERGKE
KSCKTKLRQHARSIDASMEKLKGGGGGGDSSPSISEPLTTNEPRIYADPFKQNSWICIVD
KEGTTTKWNRSMDSDVSKENNESTSSEKEFKKKYQAATHRMVHRKSSIEMYKRLQTKSFE
CDKKVIVKRKSGEFGFRIHGSRPVVVSAIEPDTPAESSGLEVGDIVLSVNGVSVLEASHS
DVVKLAHAGSDTLELEVARTSSALTSSTNAQEISVVYSGFLNKRGANNKWHSRWFALKND
NCLYYFKSQTECQPIGALLLFNYKFKYLTDSERVNTFVLEREGSKSLELQTDSKEQVHAW
KIHLEKAMESKNINDGQQWFDKSCRLVYQSPSSVEEPDCFGHLTSLEDKWRRRYCILKDA
ALLLYSDIGADKALAVVFLQGYKIQSTSGTTSGKRFSFEIVPPEPKQKHLYFYTDTEMDK
KRWIAALEYSIDRWMKLE
Download sequence
Identical sequences E0VDS9
121224.XP_002424273 XP_002424273.1.24195 vb|PHUM125060-PA|EEB11535.1|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]