SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM125750-PA|EEB11564.1|voltage-activated from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM125750-PA|EEB11564.1|voltage-activated
Domain Number 1 Region: 334-512
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-35
Family cAMP-binding domain 0.00022
Further Details:      
 
Weak hits

Sequence:  vb|PHUM125750-PA|EEB11564.1|voltage-activated
Domain Number - Region: 77-286
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000353
Family Voltage-gated potassium channels 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM125750-PA|EEB11564.1|voltage-activated
Sequence length 525
Comment ion channel, putative|DS235088.1:191671:193414:-1|gene:PHUM125750
Sequence
MKRKKNESEHVCAFTRDKNVLQQFFPSTKRFKTLRRKWRESLLISEENGRKTCTRKSTSG
YLFEKENHLSQHYYIIHPYSKFREYWEIGMLLEMFLGMTIRSYFISQSRDEVLHSYWYQI
CSLFCDLFELIDVTLLRFFTGFLDTETRNVSLESRRIFYHYIKQFRFYVSIIGSFPFEFL
VFISKIDLKEYPSFKFVIFLKFVKFFDVSKYVVHISKIYNWSEITYRVVFFLLYTFLLIQ
YLSCMMYTILFGDEFGELTNGFIKGNNTFYRQTAMFYLVSTIFCFQSGISNHFSISSLKD
MVFINFVFITSYISNTLLLGFLIQISGFSSSSFIEYEEMIQEVHKYLVQENLPKHIHKKV
KKYFEFRFGNKYFREEIILNTLSPPFRQEIASFLCKPLLMNYYSIFKIVPADLANSICLK
LKLECFLPGDIISRSGKKATKFYFLYRGTVAIYSAEGKELGHLYEGRQFGLSAFNLNDNY
YRATTIALEMSECYVLSTKDFLTCTSEYPDFEKSTNANGAGGFIK
Download sequence
Identical sequences E0VDV8
121224.XP_002424302 XP_002424302.1.24195 vb|PHUM125750-PA|EEB11564.1|voltage-activated

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]