SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM125910-PA|EEB11570.1|Low from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM125910-PA|EEB11570.1|Low
Domain Number 1 Region: 16-157
Classification Level Classification E-value
Superfamily PH domain-like 6.56e-34
Family Phosphotyrosine-binding domain (PTB) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM125910-PA|EEB11570.1|Low
Sequence length 235
Comment density lipoprotein receptor adapter protein 1-B, putative|DS235088.1:212533:213714:-1|gene:PHUM125910
Sequence
MLFELYDEKTLAETFDTETPVTSESSEDEVMFRAKYLGSTLVEKASSEETTAEAIKTILS
MSKVGGKKLQRVIVFLGLQGIKVVNIPTEEIHLDISIYSISYCSADASHSQVFAFIATND
NNTMECHAFLCPKRKTAQVMSLTLAKVFRNAYDLLADDIHKAKLIISTDDDGNSRRKEKL
DNDLLLNRKNDYNNKVTETALLIDFKTEISRNRIKTWESFDDDDDETSDKMNYSK
Download sequence
Identical sequences E0VDW4
vb|PHUM125910-PA|EEB11570.1|Low 121224.XP_002424308 XP_002424308.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]