SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM127420-PA|EEB11611.1|breakpoint from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM127420-PA|EEB11611.1|breakpoint
Domain Number 1 Region: 981-1147
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.00014
Further Details:      
 
Domain Number 2 Region: 452-633
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.28e-34
Family DBL homology domain (DH-domain) 0.0005
Further Details:      
 
Domain Number 3 Region: 642-713,767-800
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000017
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 
Domain Number 4 Region: 852-920
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000327
Family Synaptotagmin-like (S variant) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM127420-PA|EEB11611.1|breakpoint
Sequence length 1177
Comment cluster region protein, putative|DS235088.1:618219:623999:-1|gene:PHUM127420
Sequence
MERFPDSELPAAWEEDVRSNLMKHRQLFIMKTQKVTSLREELEKEEFYVEYLENLLADVE
KQKTRAAGDGEAAGEDDLNLKDNLDKQTELTEIPNKFSKSCSQNSIDLCINELADSAPVK
EKTSSFLPSGTERSFSVEDAKQSGDESEKRNLDCRQRSLTQPNLLNFITVIEISGKKKMD
MPLKCPPKPPPKTFMRPIPDGNIKPIDSNSLENENSKKRIGPTLPSPELSQIDKESVEKS
QKNEAKISDEDKSDNEDSTGKSGESSYGKITKNLLHKTEDETLNSNGLTRSNNHQSIQFG
INQEKDNLKSSETESLETQSVTDKLEDGDDSKLDFENIIESEPYYDSVPAEDSDGESLTL
PSRGSLRPSVAASNSNYVNIDYFIKQRPTIERSSSVESEENISNASEYTQIDKSDDFPSL
LVGNVSDGTYTSNSSLESSGTKISGSLDADPADMQKKIIDSVIESETIYLECLNVLLQYM
KALKATLSTSQPVISEDELNTVFYKIPELHAMHSKFLEGLKNCTSYGQHFLKLAENLNEY
GAFLHNYGRATDTVKRRSQICQQFAEITSDIKLKSLQGQILSLEDLLFKPVARVQKNALV
LDDLLKCCSSSQSDQEALKEALSLTKTFLDSFNMIETKKMFGHEDRAQRRLVKNSFMVEL
CEGHRKLRHLFLFNDVMACAKYKSTGRGKITFELKWYIHLNDLIILEETANEPKEISPPN
LLSLKSQACTIRDQILRDEEKRKSGLEKQRKKLAALEAQLVLAYPDLVLRVGQRSNRLYT
FLLSSEFERTQWIEAVHNLQNTFQQSHLPGPKNNSVSMVELQAWVTACRAFLKTNMGSYL
MRTVQDESLLRGDLHVTLGYLHGLSHPMDLFLVLEVDSYGHYFRKARSKLICRSLNPRWD
QSFVIDLEGSQNLRILLYEEAQERTILRGKSTRKLSVSWLGPNEVAKKISLSAGVTLVMR
LRFQPADVSLRRIPQSKPLGFGSKIQQVCRREDRSVPFIITSCVREVERRGMTEVGIYRV
SGSASDLARLKRSFETNCYEAEQLLKEVCVHSVTGILKLYLRELPEALFTDSNYEKFLHA
WNLGENQRDGALSSCFQSLPIQNREIINFLLDHLIRVNQHESANKMSLHNLATVFGPTLL
RPSSKESKSRDLLAQGTCDVMAQAGILHHFLMQRHVR
Download sequence
Identical sequences E0VE05
XP_002424349.1.24195 121224.XP_002424349 vb|PHUM127420-PA|EEB11611.1|breakpoint

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]