SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM128460-PA|EEB11663.1|sh2 from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM128460-PA|EEB11663.1|sh2
Domain Number 1 Region: 134-239
Classification Level Classification E-value
Superfamily SH2 domain 4.44e-20
Family SH2 domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM128460-PA|EEB11663.1|sh2
Sequence length 253
Comment domain containing protein, putative|DS235088.1:896436:897757:1|gene:PHUM128460
Sequence
MSDKRKIGLNKPPVPARPKNLVVLNSKHLPKPPEIFSVPSKITKQFNPKKNDTVNSDGEE
DAYGYLEPLSLSTSDINSGTKNMNGSTLKKSIDENLKLGEIFDKIMMRSNSSSVESPEGE
SIKHQMPVNQWQRPLPLPPTEGKSEVTSMPWYKKIDRKKGEEILRNGIDGYFLVRPSSNA
DTYLTLTLWYNNRTYNIPIRKRKDGKFALGTPKTNEQCFDSIEYMVKNYQSEKLVLYSNG
VQTGKTLLTKYPP
Download sequence
Identical sequences E0VE57
121224.XP_002424401 XP_002424401.1.24195 vb|PHUM128460-PA|EEB11663.1|sh2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]