SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM129270-PA|EEB11704.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM129270-PA|EEB11704.1|hypothetical
Domain Number 1 Region: 643-769
Classification Level Classification E-value
Superfamily PX domain 0.00000000000034
Family PX domain 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM129270-PA|EEB11704.1|hypothetical
Sequence length 1042
Comment protein Phum_PHUM129270|DS235088.1:1228568:1232223:-1|gene:PHUM129270
Sequence
MIKKKGGRGIWREKLAKTFLHEKTVIISFVFLIFVLTFDHEFRILPISNHCIILTTIIIV
VLTTCACCHGIKWAITSEKPFEISDKQTKIKRCIYEWEKKWLTKIIHGFCDSCQSLEYLT
NFNEQIRLLVKDIEKNFIKTWYSELSQNPSFLFDTHLMLEEIVFKIIKKLKKINCKNFLA
SILLLYLHHLQEYRRSMKKLSKLKWERDSKRENIDLSDVWKYLHPCSQSDQMLNYHLEKL
IKVILKEFSPNEFSHSLQCKIISGIIAKKVMRKFMTTIEDPIWLNLKLICLLNEEKYDGI
LQGGIYVVNEKILTNDDNESNFDNDKPLQLLLRKRYFSSNLFENKNYFFDTKNEKNDGKM
ATMSEDIIPTDKTTEKKTLTLQLHKDKDGGGGGGGGGNDKNDTKENISTVLSGLITSTAG
PLLPDNVSFHYHALNKMWQSPVTEVKDISESITNSLKKVFLNGVKEKRGLTRSKSTDSIM
SISSESNLKIRDISVGEELCESTTLGSSVEEEEEGLSPKEKKLTRTESSNENMMMMMMMT
TGDDDEMNGDEIKPEETESNNNLEEIKDVSPVYEEPEDFATTIAKLRSLLQQRESSSTLS
GKSNASIDSQSGAEKCHSGNVSQSMEGDSFDSQTTACDIPTDGRLFINICIPKAELVTDY
KSPHVVYTVQYDGIYMVKQEQNPNAEPEFVLQTTIIKKKFMDFLHLQTKLEENSNFRSIM
KGPSKWLNLYSSGKSEEASRKGMLETFLRQICSNVEISNSPEVHEFLAYGQIDNNNPLIK
KCSEPSVQRIDKLLANKVTGVFNSIKTVLPSFDFDSPAFVATGNEASTKTSQDQKILQGF
LNFGNKSESFELLLNFVPKEPTGESLTDDIRHHLNRTNDCIEKAVDVLDSNDWMSDQREC
RFIFPDDGTCVWNNYKESIQDDELESLDSHMPILSLLIDILTELLYDSDSWIVKDPVIRL
LKVISGHWEREIEKELVQLDWDKILGNLIRLFRLSVFQCSSKETIQVDLNDSKMILEDEI
RKFLPRKKQRNERLCREKKAED
Download sequence
Identical sequences E0VE98
121224.XP_002424442 vb|PHUM129270-PA|EEB11704.1|hypothetical XP_002424442.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]