SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM130930-PA|EEB11741.1|predicted from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM130930-PA|EEB11741.1|predicted
Domain Number 1 Region: 11-114
Classification Level Classification E-value
Superfamily Prefoldin 8.5e-23
Family Prefoldin 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM130930-PA|EEB11741.1|predicted
Sequence length 128
Comment protein|DS235090.1:97566:98594:1|gene:PHUM130930
Sequence
MSDKILEGLQKNLQKELDSFRSCQKEYQKAITKRQQLDAQLNENTCVKNELDLLEEDGEV
FKLIGPVLMKQDLEEAKQNVAKRIEYISGEMLDNMIADIDKKQNEHRDSLITLQKNMQDA
LTKSAKKG
Download sequence
Identical sequences E0VED5
vb|PHUM130930-PA|EEB11741.1|predicted XP_002424479.1.24195 121224.XP_002424479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]