SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM131460-PA|EEB11744.1|voltage-activated from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM131460-PA|EEB11744.1|voltage-activated
Domain Number 1 Region: 246-442
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.11e-47
Family cAMP-binding domain 0.00015
Further Details:      
 
Domain Number 2 Region: 3-241
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.62e-31
Family Voltage-gated potassium channels 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM131460-PA|EEB11744.1|voltage-activated
Sequence length 513
Comment ion channel, putative|DS235090.1:175602:185535:1|gene:PHUM131460
Sequence
MVVSMAVLYNLIFVLGRAVFWELNNAVPHLWWFLDYTSDAIYLIDTIIHAHEGYLEQGLL
VNDSRKLRKHYVSTGRWKTDMLSLLPTDIAYYWWSPQNCMGKVPCPVIVRVNRLFRVPRL
GEFFDRTETGTGYPNAFRICKVVLAILVLIHWNACFYFAISYVIGFGTDNWVYNTKGPKN
STLTRQYIYSFYWSTLTLTTIGETPQPENDAEYLFVVADFLAGVLIFATIVGNIGSMISN
MNLARVDFQNRMDGVKQYMTFRKVSKDLEARVIRWFAYTWANKQALDEDRVLAALPDKLK
AEIAIHVHLDTLKQVQIFQDCEPGLLEELVLKLRLQVFSPGDYICRKGDVGKEMYIVKRG
RLSVVADDGDTVLATLGAGSVFGEVSVLEIAGNRTGNRRTANVRSLGYSDLFCLAKRDLW
EALVDYPDARHSLMERGCQLLRKDGLLDENAFKKSQVEHETLKDKVDRLESSIENLEDKL
TQLIGDVTVFHNRMKRRASKIEQKTKHSSSPSK
Download sequence
Identical sequences E0VED8
vb|PHUM131460-PA|EEB11744.1|voltage-activated 121224.XP_002424482 XP_002424482.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]