SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM131520-PA|EEB11750.1|Rho-GTPase-activating from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM131520-PA|EEB11750.1|Rho-GTPase-activating
Domain Number 1 Region: 289-464
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-45
Family BCR-homology GTPase activation domain (BH-domain) 0.00000622
Further Details:      
 
Domain Number 2 Region: 110-247
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.44e-23
Family CRAL/TRIO domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM131520-PA|EEB11750.1|Rho-GTPase-activating
Sequence length 484
Comment protein, putative|DS235090.1:213047:216088:-1|gene:PHUM131520
Sequence
MNCYFGFLSYFFGVGGHEPEDPYPSLSDYHDYEPNLEFDDTELVATVGNADLKGPINDLD
QDFLESPVSDGTIEENFEAELVNAPTLLDGGLDSLQYNVKNDEEDLSDEDFSDIEKYGIV
EVAGDDPYGRKVIVVSACKLPSNKELNHQRLLKYLMFTLDKYVEQDYSLVYLHYGLNSRN
KPTLSWLWQAYRAFDRKYKKNLKALYLVHPTNFIRLVWQVFRAVISAKFGRKVMYVNSLQ
ELHNLVELPYQLSIPQPVIEHDELISKKSKKPLPPPEKDIGDSKFHAPLPTQQFGVSLQF
IKDNNDGEVIPPVISQCVRFLCQPDALETEGIFRRSANISLLREYQNKLNQGQEVDFKGD
VHLAAVLLKTFLRELEEPLMTYDLFEEITQFQCISKDERLRHVTILIREKLPEDNYHILK
YIVQFLAKVMDRCDLNKMTSSNLAVVFGPNLIWSDTAQLSLSAIGPINIERQKKNEMTKR
FYEE
Download sequence
Identical sequences E0VEE4
XP_002424488.1.24195 vb|PHUM131520-PA|EEB11750.1|Rho-GTPase-activating 121224.XP_002424488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]