SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM137300-PA|EEB11850.1|dynamin-associated from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM137300-PA|EEB11850.1|dynamin-associated
Domain Number 1 Region: 1115-1323
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-59
Family DBL homology domain (DH-domain) 0.000000964
Further Details:      
 
Domain Number 2 Region: 283-383
Classification Level Classification E-value
Superfamily EF-hand 2.92e-27
Family Eps15 homology domain (EH domain) 0.0021
Further Details:      
 
Domain Number 3 Region: 7-100
Classification Level Classification E-value
Superfamily EF-hand 5.13e-24
Family Eps15 homology domain (EH domain) 0.0016
Further Details:      
 
Domain Number 4 Region: 1048-1112
Classification Level Classification E-value
Superfamily SH3-domain 3.28e-21
Family SH3-domain 0.00046
Further Details:      
 
Domain Number 5 Region: 736-802
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-19
Family SH3-domain 0.00041
Further Details:      
 
Domain Number 6 Region: 835-892
Classification Level Classification E-value
Superfamily SH3-domain 1.27e-18
Family SH3-domain 0.0002
Further Details:      
 
Domain Number 7 Region: 966-1038
Classification Level Classification E-value
Superfamily SH3-domain 5.64e-17
Family SH3-domain 0.00015
Further Details:      
 
Domain Number 8 Region: 1324-1419
Classification Level Classification E-value
Superfamily PH domain-like 0.000000656
Family Pleckstrin-homology domain (PH domain) 0.00082
Further Details:      
 
Weak hits

Sequence:  vb|PHUM137300-PA|EEB11850.1|dynamin-associated
Domain Number - Region: 1430-1541
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0109
Family PLC-like (P variant) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM137300-PA|EEB11850.1|dynamin-associated
Sequence length 1558
Comment protein, putative|DS235093.1:263451:272374:1|gene:PHUM137300
Sequence
MSVLGPTDPLWVVQAKERSRYEEQFKSLRPENGVVTGEQAKGFFLQSQLPPNILGQIWAL
SDTDSDGRMNINEFSIACKLINLTLRGYQIPSVLPPALCNLETQFSSAGIKLEPDSISST
PSQPVTSLESQNVQGFVTSQSNLIKTCSPTPGLLPLDSMTNVVSIPMTQTISGSVQLPQI
VGGVKSVTQSPINQSTPVTPAFPVAFPTQAITSQGTNILPQAPSVIPQASPVPQILPKIS
QSTPVISTPGIPQVVTSQQSIISDGHNKFIDKGQPVDFHSPLGGPQITDWAVPHQSKLKY
TQLFNTTDRTRTGFLTGPQAKSILIQTKLSQGILAQIWALVDSDSDGKINCEEFVLAMHL
CDMAKEGRPLPTTLPFELIPPGLRRKRGSSITSVDDKQDIMAVQNSATFEDKRKENFDKG
QAELERRRAVLLEAQKKEQEEREKKEREELEKREALRAEQEIRRQQELQKQLQKQRELEM
EQEEQRRRISEQREAARKELERQRQQEWEKARSQELEAQRMKEQNNVLKLKAKNQSLAID
LATINASIKELSSKISETRIGVSAVKATIDGMRATRDSHISDMSAYKNKLKEQNQRLLFL
AQEKARLEARTKAGVTTNAAGAEQVMLAFTNKEIALKHLNEKVEGLQKEVEIKTNDIKNN
KTHLNELKTKLSNLLNECESIYLKYSEKRDIILQMKAASTNNNWDVSSGWEPPDKSWDNF
NETTDNWNTSYTPSTASGFKKYRALYKFESRNPDELSFQPGDIITVSVNQNADPGWLSGE
LNGMTGWFPEAYVELVDDSFTTNAPDLEESNKQPLGDISELPEVVTDKSNNENYDNEIYV
SVYRYQSSEPGDLSFEQGETIYVTKKDGAWWTGTIGDRVGLFPSNYVEKIEPENKFDSSE
FTNKKSDGGEVEDNTIPVQEPTDEIEKEISPSPENTNTGVKEQETFVESNQPKPVTPDFS
SITAAQTKLSKKGEIATVIAPYQATSNEQLSLARGQLVCIRKKTSTGWWEGELQAKGKKK
QIGWFPASYVKVMASRRLSQTTPDIDGEPNVDKVIAMFPYKALNDDELTFEKDDIITVIS
KDEATWWKGELRGSIGLFPCNYVTPMNGSLTSTNSDWREKLRQEAIQELIESERSYIADM
TLVRQVFEKPISKSGLVTSDQLKKIFLNWREILKGNYTLLKLFDKRKKESPDQVIGCIGD
ILCDYLPKMGGYVEFCSFQLNAGQLLQHLTESSTAFREFCKLCQRDPRTQGLPLSTFLVK
PMQRITKYPLLIEKVLEHTPMDHPDRINLERAHQKAEELCTQVNEGVRENENSERLEWLQ
THIIMDGMEENLIFNSETNCSGHRIFLHSGVLNKVRSNKELIGFLLSDCLVLTYPSKPLL
NGQFSMKNFNQHLRLYKKEALQWIKQIKQACDKFKNVDNTSRYFKSEDGLSVGRLLVEVV
EGYNLSFKCCFCQIKLNNQVQNTPPCGPPFKWNSAMQFMIQNFDNDDLIISIFIKHDFKP
DELFDCGKIQVKEISEQTRSGGPVLRKLPVGGGGGGGGGQINISEILLKLDVVLFNVS
Download sequence
Identical sequences E0VEP4
vb|PHUM137300-PA|EEB11850.1|dynamin-associated XP_002424588.1.24195 121224.XP_002424588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]