SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM145570-PA|EEB11922.1|tens from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM145570-PA|EEB11922.1|tens
Domain Number 1 Region: 1031-1178
Classification Level Classification E-value
Superfamily PH domain-like 1.24e-46
Family Phosphotyrosine-binding domain (PTB) 0.00000676
Further Details:      
 
Domain Number 2 Region: 891-1019
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-23
Family SH2 domain 0.0014
Further Details:      
 
Domain Number 3 Region: 168-300
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.18e-20
Family PLC-like (P variant) 0.0065
Further Details:      
 
Domain Number 4 Region: 1-165
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.59e-16
Family Dual specificity phosphatase-like 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM145570-PA|EEB11922.1|tens
Sequence length 1186
Comment putative|DS235100.1:200653:213080:1|gene:PHUM145570
Sequence
MDFSFVTERIIVLYFPENVSPQAFHQGHSQAAHLLTTKHSNNYTVFNLTEPRRSARSQHA
RVRELNWTPGLAPPLDKLCSICKEIETWLNGDSHRVAVLHARGNRERIGVVVASFMHYSN
ICGTADQALDRFAMEKFLDDKIQELEQPSQRRYVDYFAGLLSGNIRINSAPLYLTHVTVL
GAPAFEGNTEGVVCRAFIKIYEGLMPVYTSGVHRITPGTRQFTVNVAGDRRNQGLQLRGD
VLVKCYHKHPKHREVIFACQFHTCTISDYTLSFTRHELDSAAYDLRFPLDGAVEFHFSST
PMPRLPLPAPTPAVMIDPIDDDPIVRWDSYADLSLGVIEQESDVDHHHVSHTFGPLDGSI
YATVAKKVSPVTAVAVTTISSPRTVSMDSGISSAGNGLLNNNSNASSSSPVTASNLDTQK
AWDELLREMQITVESIPDTSSPRTNVSAFDDLDSVAYIDDPDDIPYHARQDSRPFTYGSA
PGPEMLRGQPGLSSPQLVRKASFGKTSGYASDSKYNNNNNSKYDKYDKYEQNSWTLKPQK
TENPWAARSEQTWIMSTTPRNTKSWDTTDTSYKWRQTSAPVTRKSFDFLESSVQNNNGLT
NGSVTWLQRQQQKLRERKEAALRMERRPQEVRLISELKSQYNHHHHHQRPSASHRDGYTS
DTTHFADDDDDDDDLSIPLHVQTSPHRNLGSAPVSPLPRRILQNGVVERPFVQVKRTQET
RKYAIDSNSTSPNELGLLTLVKDDKGSRYTNEDALSALITSLDRQRITESCNRYVSRNSH
EVPNHSVLWSSDDSLSSWRTASVSDDPGSPSRTNSPRPVTPAFPVFPRTPYANGSVVQFE
TNGLPPKSPTAQRKERSPSPSVDSQMQYSPRSTTSSIVNGSYQSQSQRSSIHSNSEPPQE
VSPAHVKFVRDTSRYWYKPTISREEAINMLRNEPPGTFVVRDSNSFAGAFGLALKVATPP
PGKSGSGPDELVRHFLIEPTSRGVRLKGCANEPVFSSLSALVYQHSITNMALPTRLLLPE
CERKIESLNTSTAQQLLAQGAACNVLYLITVDTESLTGPQAIRKAINQLFLTKPLPVAVI
VHFKVSGQGITLTDNKRQIFFRRHYPVAAISHCGLDPDDHRWSHTADSSGIPISSHRCFG
FVARKPASKTDNQCHIFAELEPEQPATAIVNFVTKVMMTSAYKPNI
Download sequence
Identical sequences E0VF33
121224.XP_002424660 XP_002424660.1.24195 vb|PHUM145570-PA|EEB11922.1|tens

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]