SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM148130-PA|EEB11978.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM148130-PA|EEB11978.1|hypothetical
Domain Number 1 Region: 56-220
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-31
Family DBL homology domain (DH-domain) 0.0000102
Further Details:      
 
Domain Number 2 Region: 213-336
Classification Level Classification E-value
Superfamily PH domain-like 2.47e-25
Family Pleckstrin-homology domain (PH domain) 0.00018
Further Details:      
 
Domain Number 3 Region: 9-67
Classification Level Classification E-value
Superfamily SH3-domain 1.31e-24
Family SH3-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM148130-PA|EEB11978.1|hypothetical
Sequence length 800
Comment protein Phum_PHUM148130|DS235100.1:744573:747978:1|gene:PHUM148130
Sequence
MASSSSQSTLTVQAVYSFKGKNNDELCFKKGDIILVTQKEEGGWWEGTLNGTTGWFPSNY
VKEINLNRDEYRQLVGNIDSVFDAHSKLLIALEGCNELPPIEQRVGKLFLTSASQIKQIH
LLYCSSHPRSICILNKHKDALNAFMESQGAASPGLLVLTTGLSKPFRRLEKYSGILQELE
RHIEENHPDRGDTQRSVSVYKDIWNACSTKRRQKEQELEILTGGVRGWEGEELSSLGEII
HMGSVAVGPYHRDRYFVLFPTTLLILSVSSRMSGFIYEGKLPLTGINVTQLPDTESYKNA
FEITGNLIDKIVAVCQTKKNLHLWIDTLRQAIQSVKKSSTSSSHPPSHVSSSYTCSYAGL
TGYFSRLVKCGLITRNFDFSDVKVRRSHKVECVIFPTQLSFEIFKASRTWFKSQTIELDS
MSTSTDRTERIRTYKRQNAIDMVDSSDSMNSSDTNSFEFIKNSHSHSNLRDCVINFESEC
ESEKLKNVLGKPNLQPGNSSFDFLPNVPATHRTYEDLSVLGFCETGRKNKKRRSKSMPSL
TNMRNENTFFASSFERSASLGIITVMKSFERDDSIECRKKTNSEIIRTDFMDQKSSNDLS
SICFSTSYICALNASAEDNRRQSLPVENSNLNDGCFRFSQVGLSSRYCNDFLFASPRSSD
SGLADIAGTGTLIFPNHSENCEKWRYKVDSLCDSSNVFYPTTESNNLDYVSDGVVTTTPT
ISCKNIFIENPSRHTSSSNIFYDPSAVPRQNEDVVNNGGVYRSGMYAHWWLKTRIPAEAF
GDKTKSSIKSSKGKKSVRTN
Download sequence
Identical sequences E0VF04
XP_002424716.1.24195 121224.XP_002424716 vb|PHUM148130-PA|EEB11978.1|hypothetical

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]