SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM149600-PA|EEB12015.1|Huntingtin-associated from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM149600-PA|EEB12015.1|Huntingtin-associated
Domain Number 1 Region: 1194-1371
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-49
Family DBL homology domain (DH-domain) 0.000000183
Further Details:      
 
Domain Number 2 Region: 1906-2101
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.16e-48
Family DBL homology domain (DH-domain) 0.0000185
Further Details:      
 
Domain Number 3 Region: 1378-1495
Classification Level Classification E-value
Superfamily PH domain-like 2.43e-33
Family Pleckstrin-homology domain (PH domain) 0.00000659
Further Details:      
 
Domain Number 4 Region: 2109-2234
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-22
Family Pleckstrin-homology domain (PH domain) 0.0025
Further Details:      
 
Domain Number 5 Region: 770-911
Classification Level Classification E-value
Superfamily Spectrin repeat 7.33e-22
Family Spectrin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 1028-1147
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-18
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 7 Region: 437-580
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000034
Family Spectrin repeat 0.0083
Further Details:      
 
Domain Number 8 Region: 201-334
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000365
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 9 Region: 662-796
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000173
Family Spectrin repeat 0.0081
Further Details:      
 
Domain Number 10 Region: 583-690
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000034
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 11 Region: 1614-1680
Classification Level Classification E-value
Superfamily SH3-domain 0.00000561
Family SH3-domain 0.0034
Further Details:      
 
Domain Number 12 Region: 94-156,198-234
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000523
Family Spectrin repeat 0.011
Further Details:      
 
Weak hits

Sequence:  vb|PHUM149600-PA|EEB12015.1|Huntingtin-associated
Domain Number - Region: 5-90
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0968
Family CRAL/TRIO domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM149600-PA|EEB12015.1|Huntingtin-associated
Sequence length 2251
Comment protein-interacting protein, putative|DS235101.1:72896:137540:-1|gene:PHUM149600
Sequence
MRGATWGTVKPILKVLQEHFSGYVHVAYIIKPDNFWQKQRTSLASHKYKFETNVIGLESL
PKIIDTSQLTADLEGTYHYDHTQWIEMRLAVEDFVWQAADLLDRLDDLQEDLSRKDFADD
IQGAKHSIDIHADLKKKIMKAPVEEIDMIGQRLLRRFFFFKRFSSPIHLGKIVEYLTGYD
SGYSGRDSEASTVSLNPDLQSAVPQILQNLEAIHASQQHLLQLWHHKKMKLDQCFQLRLI
MFEWICHKRDVFLMNYVEIGHSYQPAIELQEEHSHFAMSSMDVYVNINQILNVGSRLIES
NHYASQHIRTVATKLDRVWKEFAAALEKRTSVLQLSVLFHRKAEQYVDNVQTWKQACDNN
LNIPNEIIILESYIRQHQSLYESMCQAYTEVHSTSKKLLYQLDHLVQICNQPGNDGNRKH
VDTIDGVVGRQNGNPAADYSEGASHVLAVIHQILNHHRTLETKWQAKKIKLHQRLALRLF
QEDVKQVLDWLTNHGEAFLEKNVAIGRNLQKARVYQKSHEHFENVAQNTYTNAEKLLTAA
EELAQTRECNAEEIYSVAHELENHVTSFANRVEQRRRRLDYAVRFYSHDKELSNWVDQLR
QEIQNVEAPESLEAAEQLLEQCSQQKESSLDACNRTIGEGQALLQELRSIGLTSEMDTTG
SVTAVESALDRINKQREELEELWATRKLKLDLCLRLRLFERDALEVSSQLELWAEKLQHT
ELSRNAQKAEHLLRLHNESVAHMQDTTFQVLQTGQELAQVFETSKISLMADSQYSAQTRV
QVLLEFLHEREMDLEDIAEIKRVKLEQCVQLCQFQNDANQVVKWIRNGESMLTASFTIPN
SLQDSEQLKKDHEKFQVAIEKTHTSAVQIKHRSEALINANHYDPNSIREIAEEVTKRWQQ
LVTCAEERHKLVTASSNFYKTAEQVCSVLDSLEREYKRDEDWCSSEKVVSGDKIVAIAEH
INKHQEKKEAFLKACTLARRTAETFLKYTSRSLQYYNYQGEAGTRNAEQRVKGKLDILSQ
ENKVLEYWTLRKKRLDQCQQYLLFERSAQQALEWIRDKGDLYLSTHTSVGQNKDETETLL
SEHNEFKGKAKETRERVKLIIQLADNLVENGHAHANAIKQWVAAVDNKYKDFSSRMNKYR
GQLENSLGIQAKAELKQDLSIDRNSDSSLDNKVKEPTSKDLKELNEEKRRSARRKEFIMA
ELLQTERTYVKDLETCIKVFLNEMRTSSSLPIHIHNKSDVVFGNMEEIYEFHNGIFLKEL
EKYETMPEDVGHCFVTWAQKFDMYVKYCKNKPDSNSVLVNHAGTFFEDLQKKHRVEHPIA
AYLIKPVQRITKYQLLLKDLQSCCQEGQGEIKDGLEVMLNVPKKANDAMHLSLLENCDIS
LDKLGEVILQDTFQVWDPKQIIRKGRERHIFLFELYLLFSKEVKDSNGKAKYIYKNKLMT
SELGVTEHIEGDECKFAVWTGRAPISDYRIVLKASCLDVKQTWVKKLREVIQETYFSTAL
PLSLPKSPAKGKSGSSQRSSRDMEDNGSLDENAERVSVASFSSGNTTDSDKRCQMMATGE
KPQKSRRKISLPWFRQGSVNKPHHGLTRQHTIDTPGGFHARFLHRQHSQVEPVVEMTWVI
GDHVAAPGSQELTVHKGQQVEVLDVNVSSPDWCLVRMSTSGSVDSPPEGLVPLSILKQPP
GLRTSPCRKNSNDLETEPGTSDGTGTTSAGHAIASSPVNKRRVFSGRKWLPPPLRKLSQG
KVEKNNTQDRPQLKKTPSDKRFRLPSIEMGNKQSSTTAEEELESSNRLENGEEGEEDAVE
LPPPMKPIQEPLLVPTEDSQGERISELSLTHLEGAAEIEQIVKERMEQHTENREKNNTLN
RDGKSVGDVTATGAGTTTPTTGSSETNNSRNSVVDITTSSSSTTTNNNNPEDAMLKRDYV
IRELVDTEKDYVRDLGLVVEGYMALMRNPDCDIPMPEDLKSGKDKMVFGNIEAIYEWHKS
RFLVSLEECIEHPEKLGPLFKKYERKLHMYVVYCQNKPVSEYIVSEYIDTYFEELRQKLG
HKLTLGDLLIKPVQRIMKYQLLLRDIAKYTQRADLKSEMEDLRIALQVMHVVPKSANDMM
DVGRLQGFDGKITAQGKLLLHGLLMCSEVMAAAGAKAKELQVFLFEQNIIFSEAVGKKTQ
FTDPMYIYKAHIQVNKAALDETYCDDPEGVKFVIISTDRKKSPMGFVCAASSRESRNEWV
TTIKNMLQTQKDFLKAIQSPIAYQKELTKET
Download sequence
Identical sequences E0VF59
XP_002424753.1.24195 vb|PHUM149600-PA|EEB12015.1|Huntingtin-associated 121224.XP_002424753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]