SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM155340-PA|EEB12095.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM155340-PA|EEB12095.1|conserved
Domain Number 1 Region: 264-486
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-44
Family DBL homology domain (DH-domain) 0.00039
Further Details:      
 
Domain Number 2 Region: 490-626
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000871
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM155340-PA|EEB12095.1|conserved
Sequence length 1214
Comment hypothetical protein|DS235111.1:199713:210476:1|gene:PHUM155340
Sequence
MNRFSFYLFRLLQVRSRSLTHIDQIEQGQRGSGIFYQGMNSEKSGEQQQQQQLSVPTSVS
GKHRRQMLSRSEASSSECFSVGIEGIGEDGNDEFVQATKDTILRDVILDICKRKGIDLNT
SNVYLDANKSPLPCLDIDTSWMGGKHIRIKVNDRVMTSLKKDQKNTFAPPIKKISSSYKS
VKSGTKTHNVSSEDSSSMMEPGTSGGDRKSKRWSGFFGTSRDTSKMETLIDLLDSYTKNG
IYEYKEDTYKLEADWKSIVINSVNFDDRQSQQQEAIWELLRSEIDYIKMLRVVSHLFIAC
LVNLQSNQLLLDIDNKKLFGNVEEIYSCNDLFWKKYLAPVVETSRKTGEPLNPDLLREGF
MDFHNMFKCYETYCTQQSKCQQYCREKLQQEQDNDLFTAYLAWCETQKECNRLKLLDILV
KPMQRLTKYSLLLKAILKHTINQNHKDSICDMIKSVDFFVNNVNSTLKQNQDLETMKQLM
SKIESYDVIESKDDDLSNLIQKYSNLNLTYDIPGTTSKRSLLFESDVKYKDAMTSSKIEV
HAFLFTDFLLITKPVKRLGESRIKFKIIRQPYVIDHLVTQEITRDPPSLACVYLSIYRTA
CTAFMLSCGESELVRNWSDAIKKAKSLYGSLKSHQGFGGHIPQTPTTMSISRQHSGYANE
DISIGDNVEENKTMMTYNLGLWTGKSPKGSSYGSRISSLVHSHSGSMEMTENISSISSVS
ASRGVSVENNSEVRGSSLSSDDGNQNLSSSPRVELTTSPKIERKDASSSPSVEKRENQTT
MQKPETKLFYRKSVTKTKNTLTIQVPHLGQSLPNLNIASSSGGGGSSPNPCPPNSLLLAP
PKSHGGLLSPSQRGVSYPPPSPPRGSLKRGFAIFPKNPPLVKTGNVTMELSRSISVVQSS
SSSSSPPPPPPPSSSSSSIKPENQTEEKKNKTIGLQTNLDDDKSKIDTSKCDQCNCSVRR
TIVKTTGKKLVRSDKRYYTEGGGGTIDDLKVKQLDSSLYKKLSFNSGNGRRSATTTGNNS
DSIESPPINNKHLSIASVQSSSGFSSAGSSSVEGLFTKDDVINFDSKSIKVKEEEIIERI
NADSNQRPRQRMENSRESFKKCRDENDKMSAKRENEEQRLEPFTHFETSTRRRRSISTTG
CKRKSSLIILDEYVSSVSGDPSSNNYKLTLKHFHTVNYTTVNALQLENLSSRLPPPAGKI
LDTREKKRKRRNTR
Download sequence
Identical sequences E0VFD9
vb|PHUM155340-PA|EEB12095.1|conserved 121224.XP_002424833 XP_002424833.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]