SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM156950-PA|EEB12116.1|exocyst from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM156950-PA|EEB12116.1|exocyst
Domain Number 1 Region: 277-501
Classification Level Classification E-value
Superfamily Cullin repeat-like 8.89e-47
Family Exocyst complex component 0.00073
Further Details:      
 
Domain Number 2 Region: 113-250
Classification Level Classification E-value
Superfamily PH domain-like 2.14e-19
Family Pleckstrin-homology domain (PH domain) 0.00028
Further Details:      
 
Weak hits

Sequence:  vb|PHUM156950-PA|EEB12116.1|exocyst
Domain Number - Region: 591-649
Classification Level Classification E-value
Superfamily Ribosome recycling factor, RRF 0.0611
Family Ribosome recycling factor, RRF 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM156950-PA|EEB12116.1|exocyst
Sequence length 688
Comment complex component, putative|DS235111.1:458646:461745:1|gene:PHUM156950
Sequence
MVDNLIEKFNVRELSQKCVGGQELQQQRKAIQAISESTSVLLKKNVYKNYIQFIETAKEI
TQLESEMYQLSHLLFEQKSLLETLIDSTNFNESLGEEDAKRKQKEEEDRVRVLTSILEKV
EGCTGLLEVKDRVLLYEGDILELDPVEYSIIHKTHAYLFSDSLMLTSWITNRRGPAKYKM
YVVYNLNSMAVVNVRDLKTIERAFKILAYPDTRLFQCSSIESKKEWLDHLDQAKKAILAS
EKIKRESSQTGPAPNEEPINIDSPTTLFDEESIFPNLNLPDWFLESPEEIDVFIAERHFE
DALELLNKCKEYCDGLDEQQKDSVVIDIKNKIENRKKNLIDVLMKELEVSPDKSLQGGLR
AARRAVRLLIALNKTIQACESMLKLCTSIMKKELKCVKREGATILYIRQLGTIFYQTLLD
VVEEFRKIFPESSACLASLVIWSNSELTHFMSHVIKQIFVPQSGLSIISECVSCLREKNS
QLCNFGLDLQYQMDGMFLKPVTLALQDSRDKLIEAIKHRSGEEKWHLMNLSNKNNLNKLI
SEFNDLGLTSVHVYTRGDCWLELTSNTVAFTKSVMTLFEDCMKLYSSHLFHVIEDVLYEI
FNIQFKVLQSAKKLHKSSESEAQIINKNVKFLLDDVLKLIEKNFENKTKISSERIGGLTT
EYNNLKLGIEKPKPAPRSITKYSSEEFI
Download sequence
Identical sequences E0VFG0
vb|PHUM156950-PA|EEB12116.1|exocyst 121224.XP_002424854 XP_002424854.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]