SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM157670-PA|EEB12139.1|hypothetical from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  vb|PHUM157670-PA|EEB12139.1|hypothetical
Domain Number - Region: 23-122
Classification Level Classification E-value
Superfamily Prefoldin 0.034
Family Prefoldin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM157670-PA|EEB12139.1|hypothetical
Sequence length 184
Comment protein Phum_PHUM157670|DS235112.1:134695:136240:-1|gene:PHUM157670
Sequence
MPFIDDDLLWSPEAETKIDNLNLNQCLETTNQQQEPPELSQSDLTGLVSSLESSLSEVDV
ELFNQLGCSLELDTFLTDFAGVEVKEENNNDIVSDVSSTTTSNNKNILTTQQALNELRQR
NAKFNIAAANPLLAEKLSSPSSIVSGSLGNNNGNYNGGHDTSASSGAHTRTHGMRPAVKG
KKKL
Download sequence
Identical sequences E0VFI3
XP_002424877.1.24195 vb|PHUM157670-PA|EEB12139.1|hypothetical 121224.XP_002424877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]