SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM163920-PA|EEB12200.1|E1b-55kD-associated from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM163920-PA|EEB12200.1|E1b-55kD-associated
Domain Number 1 Region: 389-550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-28
Family SPRY domain 0.01
Further Details:      
 
Domain Number 2 Region: 585-729
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000294
Family Nucleotide and nucleoside kinases 0.076
Further Details:      
 
Domain Number 3 Region: 2-40
Classification Level Classification E-value
Superfamily SAP domain 0.00000000788
Family SAP domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM163920-PA|EEB12200.1|E1b-55kD-associated
Sequence length 1102
Comment protein, putative|DS235123.1:89233:97017:1|gene:PHUM163920
Sequence
MDPAKLKVVELRAELAKRGLDQKGVKAVLVARLQEALESEEKGEEDEDEEEYKDVEENAP
LKNDPGGLDLTTTEDVQSSELEATNLEDDSVNFSSQSDNPETKIEEPIISEFSADESSNI
NAPTNDAVVDALVQSVDCSDSKSINEVSGANLISTDTQQSEQSTTIVDVTNEPDIPKNDD
ESKENFQIYEEDSSKSFSHEDSSSKKNFEDQFIDTSTQQDTRDESEQSFQMHDSSLHLDD
SNAQDANMPDNVTETEDTKPCPEIIECDNKENEDLKMEVDDTKPPTSELKTIKEPETEEI
RTEEVENAEMKTEEEEEEEERSPKSNDKKVDEKDRKNRWSDSKSNEAKKRPRSPSEKRKS
SPPVRKPDDEPEYDEKSVLLIDSDLHMLISKENFFSATLLSDNGFGFVWAGVRATYGFEK
GKIYYEVRITKNIKVPYLENEMHPNILRVGWSVQKTSLQLGEEPLSYGFGGTGKISTNCQ
FQNYGKSFIVNDVVGCYLNMDSNPIEISYTLNGEYQGVAYNVDREELKGQPLFPHILTKN
CCFEVNFGNRESWAQPLPGFTNIGEVPLEDRIPGPKRPERKEDCEVIMMCGLPGSGKTTW
AMKYAEEHKDKMYNILGTNALIDKMKVMGVPRKRNYSGRWEVLIEKCTKCLNTLLEMGGY
RRRNYIIDQTNVYPAAQRRKMRGFEGFVRRAVVIVPTDEELKSRIAKREAEEGKDVPDSA
ILEMKANFALPEKGEIFNEVVYTELQEAEARALVAQYNKEGNEHGFFSNNQQQKRFRAED
TRNDRRDFTNHGRSDSGEQRRMDNRGRQDNRGGHDGWRDRGFNNRRRGDNRGGWGGPPRQ
GGGWRDNRGGGGGGGGGGGGGGWRGGPPNRYNDRGGHGSRDMRDRNRDYRDRRDNLGGNK
MQDRRGDRDDKNRQKPMQGQMANWSSQSQGYNQGWGQNYGNQAWSNWNQGYNQQQWKNYG
QPPQQAWSQQGWGNQGWGNTGWNQQYYNQYQQNWSQQQQTQGVSANTDSSQGSGSDNSAM
AAAYASYGQTTTTQVVLKLKMMLKAGSWPGYTTVGSSGYASVGSSGGSGIGGSGSGGNSA
GSGVASYSTMQKQYRQDPRKSS
Download sequence
Identical sequences E0VFP4
121224.XP_002424938 XP_002424938.1.24195 vb|PHUM163920-PA|EEB12200.1|E1b-55kD-associated

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]