SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM164470-PA|EEB12215.1|suppressors from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM164470-PA|EEB12215.1|suppressors
Domain Number 1 Region: 364-472
Classification Level Classification E-value
Superfamily SH2 domain 1.08e-26
Family SH2 domain 0.00000394
Further Details:      
 
Domain Number 2 Region: 476-517
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000000275
Family SOCS box-like 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM164470-PA|EEB12215.1|suppressors
Sequence length 526
Comment of cytokine signaling-5, putative|DS235123.1:162381:164689:-1|gene:PHUM164470
Sequence
MGQKLSELRGLLVAMEGEDKIETKENDDDESSSYENLKSDKTRHICNDNDSSSSFNGNDV
GNVKEHFESIYSTNSSENSVRTDEVNGNVLPQSHHSDSSKCDGAKQNCTCSTKTKSQCEK
SRKVSSNNPSHCGNLKRNSLRTMSFVSKRRTHGKTIRTKDSIGDNVKKRNNWVLKFNCAK
LKTGFHGSSSSFVESDIPHPNIVCDSCICTGYRRTEDHHLGAGVVFEATSGEESSSSGAT
RRKSCPAVTGTKSEEPTRSNPIIDLSKFNPEDFPIEDCDERARLERAREIAEGVEPPPGF
QPGQHIQLLCPPEFTLDNLTMLFQTHLGLHTAAALSALSQIDVNLPPAVQRIVHTQVDYI
HCLVPDLLQITLSSFYWGKMDRFEAERLLEGRPEGTFLLRDSSQEEYIFSVSFRRYGRSL
HARIEQWNHRFSFDSHDPGVFSSPTVCGLLEHYKDPSCCMFFEPMLAIPLHRNFPFPLQH
LCRATVCSITKYDSINQLHLPKALKSYLKEYHYKQRVRVRRFDSEI
Download sequence
Identical sequences E0VFQ9
vb|PHUM164470-PA|EEB12215.1|suppressors 121224.XP_002424953 XP_002424953.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]