SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM165150-PA|EEB12223.1|LBC from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM165150-PA|EEB12223.1|LBC
Domain Number 1 Region: 39-265
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.37e-64
Family DBL homology domain (DH-domain) 0.000000602
Further Details:      
 
Domain Number 2 Region: 270-390
Classification Level Classification E-value
Superfamily PH domain-like 4.71e-24
Family Pleckstrin-homology domain (PH domain) 0.0000703
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM165150-PA|EEB12223.1|LBC
Sequence length 391
Comment oncogene, putative|DS235123.1:255023:257200:1|gene:PHUM165150
Sequence
MVTATQQRAQESVTVTLTPSNIPPLLEDSDTEAEPDPPDWTRRVDENVLKSLTPREKKRQ
EVINELFHTEKTHVRKLKVLDQIFLKPMQENQILPSDQLHLLFQNLEEMLDIHSRFNNAM
KAKKKEDPLVGDISDILLAMFDGPAGDNFQRAASVFCANQQIALEQLKERRRKDTKLSNF
LTEAEGNPLCRRLQLKDMLPTVMQRLTKYPLLFENLAKYSPKGSEEEKSVQQAVERSKDI
LNYVNQAVRAVEDHQRLAEIQKRLDKSAFEKVDHPMTNEFKNLDLRTHKLIYEGSLNWRI
GNRQKLIDIHVLLLHDVIILLQKQDEKYVLKFYNVNTPSGGAPALSPIVKVSSVLVRDNA
VDKTALYLVNTSHNLAQIYDLVASSPNERKM
Download sequence
Identical sequences E0VFR7
121224.XP_002424961 vb|PHUM165150-PA|EEB12223.1|LBC XP_002424961.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]