SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM169900-PA|EEB12291.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM169900-PA|EEB12291.1|conserved
Domain Number 1 Region: 60-272
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.66e-50
Family DBL homology domain (DH-domain) 0.00024
Further Details:      
 
Domain Number 2 Region: 549-844
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000026
Family WD40-repeat 0.04
Further Details:      
 
Domain Number 3 Region: 288-359,452-504
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000419
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM169900-PA|EEB12291.1|conserved
Sequence length 1156
Comment hypothetical protein|DS235129.1:49424:54011:-1|gene:PHUM169900
Sequence
MRRGSSNQYELDNSQDRLHIGGKMPLLSEVDEESLAQSNGVGTTPGFSRRQVPPTLPHPP
LNLTPQQLKRRHIIAAIVHSENSYVATLQRLVNDYKKPLEESSPAILSSSKISTLFLRLP
EILQCHTLFRIALAEAIRTWDKDERIGDVFVASFSKSIVLDVYSGFINNFSVAMDLAKTE
AKRKSALADFLKVKQISSHDRLSFFGLMVKPVQRFPQFILFLQDLLKHTPQGHHDRMSLQ
LALTQLESLAEMLNERKRESEQFQAFKEMLRHVSGKFARPSLSDSDRYLLREDNVTQLEF
NQNGVVTKTKNRRLLLLNDLLVCVSVAPKSADDFSSSERLTLKWSHPVTDIEIQDTSASP
TLSRLLTAGLNRSGSLKKESTADGGTNHQPVDSICQEMADLMHDYEVLSRITEWVGTLRG
NYKALTVDSMKNLLHDIQAEIQKKDEVMSWVDSCCLQITLKSKNKEETVTFQTDNPSVKK
EWITELRLAQLALDINNSPAWEIPEEEQRPSTKMPLFVKAQSVYSSKHQTEVQSGCFYTV
AINKPSARHRRLRHQNYLWVCTSDGVSSHISILAQQAHQASQLKNVQAFDLVETRVTCME
FVKGVDGPGLESDLVWMGTNSCRILIYSAGEPEKEEEIATFTVAAVPVQIRYHSNSVFVA
SANGNLIIYQRNDSGGWPTTPNLTINLGSDPVSSLLPINTSLYAACGKKVSVHCIFTGEI
QKSFSVLHDQVGNVNLMAHSGVGLWISLKNSSTICLYHTETFKHLQDINIANNVLRVTTL
ISVTSLMACKGLLWVGTNVGIALTIPLPRLEGVPIISGRVNISYHAHFGAISFLLALQPK
SYICVGKKNSDEKKLSVDKSKQQVDRTTTTTASPIMLRKKKAVKESENLRRMSKTLPRGI
FSSSSSSQSSNEACDVYGLYGELMNCKDFENEEAANTDPIYESLRRSDPDLSALPGKIST
LDRRLKLKTSRPRSLDLSNWSVESHTSSVYTSSGSEECVQKQRSELNRTNSNNEGKTVKN
KDLKRSGSTGALPNVTFDQELIKCRRTVAKKDEKNKEGEEEEEEGREGGGGGGGEGEEMK
KKKNEAKVERCKTLSKCKTMKGTAADCGRRTIITLMGGRGYVNWRQTCCSTDKSKLSTVK
EPDSNDAHIVIWEMKL
Download sequence
Identical sequences E0VFY5
vb|PHUM169900-PA|EEB12291.1|conserved 121224.XP_002425029 XP_002425029.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]