SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM169920-PA|EEB12293.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM169920-PA|EEB12293.1|conserved
Domain Number 1 Region: 882-1062
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.16e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.0000898
Further Details:      
 
Domain Number 2 Region: 683-787
Classification Level Classification E-value
Superfamily PH domain-like 2.17e-24
Family Pleckstrin-homology domain (PH domain) 0.0006
Further Details:      
 
Domain Number 3 Region: 20-81
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000000105
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM169920-PA|EEB12293.1|conserved
Sequence length 1702
Comment hypothetical protein|DS235129.1:90814:104377:-1|gene:PHUM169920
Sequence
MAKEKRLGLRQGNANLNEPMDTIFVKAVHEGTSAHAAGLETGDRILSVNGETIAGKTYAQ
VVQQIHNTPERLNLLVVPKEEDIIQQYYSETAHNPKTNARPRLRSPEVVQDPKRASALSL
PGTQRNMSSQKMMMSPVRQQQSPPVFGSWQHGMHSSNPETVCNNSLMWPNQSIGSENRGT
MEMHRLKMQNSRWGNSGSGKVQTDQQISVIKTNNNPATFYSNASGCRLSLDGGTLDRRES
SSSSTLTDDSVIMSRIRKSCEQKEEFLRNTATPLYSQIIAREFYARPQKFQKQIWPPNSP
PPPPPSESEDLELKSAVGDDRPSLKSGQLQSMKTLSRVQDGSPKSFPSETLDGETCETPQ
SWHDSPKNRSHSEESDSARHVGGAGGQRKLHIVSQRAKQFETGQLEEEENKTHFYRSELA
RLSGKKTVPNVAVRKQEFERVGRDGNQSGGKDFCSSAESFSSSGDAGGILSGNRTVIVGS
KQIHVDPPTDFKQLGPEVENQDRNKENVSKTSKSWTSLQSNPSKEKLILVETNEKGKEEE
RQRHKAVRQDSYLAAVKPVSSNAGVHNNAGSQVTEVVVRREKNSTLSSAEDDRATRRISY
LKATSNDQMNIGLDKDSDRSTVKRKWMYPMLPGDIQRLRRIFEEYSGIVDTGSSSNNSNN
EGSSKRHTVINIEKSELNENLKIIKDGWLNCKVAVIDGKRAGDRSWKQIWAILRGPYLTT
HKDKQAEQAEYTIDIRSCTVDIPQNYTKKKNVFKIKTESETEYWLQAEDQDDLDGWIKIL
DEQSENSNTLSPQAVHKGIKKLGNLRTRSPTGQSPASKTRKATQLEQPVSPKSKTWKGKL
GKQFKKMQGSGGSPSSPTISYPEGATIKVPIELCPPSTISEYIPLIVEKCTSIVESRGLE
VVGIYRIPGNTAAVTALTEAVNKGIDSISPEDPRWNDINVISSLLKSFFRNLPDSLFTAE
LYPKFIEADKIVDPKVRMVTLRKLIKELPEHNFETLKHLLYHLKKIVSKSSVNKMETQNL
AIVFGPTLLTTTDLMALVTDTSHQCRIVESLITHVDWFFSNDDVNTLENLTPPMSSSDAQ
VSSETPPNANLLLGNIHKIEGYSRLEHSPNKDMSPKDIVSSIISAANRKISKGKSKKVDK
TVTQIESETKTVTKKTELIKEEELLLEPSTSVAASIVSSFVGEILRNKNGDISKSSTTSD
LNSNDVIRAYSGLDSNTIERIKRFEQETHAMLQRDPTKTRRGGDTETNWLSDKQIIEMKL
QQAKRELENEEDVLDALTNASTDLTKKSNSDRSSFSSHAENNIPSTIRKGGLYENEGSDP
TTTPNSGSLKRFKSNRDESNEIITMTSSLDSLHDAGKSDTSDDGNDLVLSLTKTFDKTLK
SVLNMSDDSSLEEEKKSMTEKAEYENVIENKESKLCGQNINNNNNNNNNNNEKKMGSEND
EWVKDEEESKKSCVKSSENVKTLIKEKNVKKTPEIVAETVLRAKNTENASNLKRSESLNK
PEKPDSGCTKLKRSESLNKNEKENDFIKLKHSDSLKNDLKRSDSLTKYEKTETNMNKRKQ
QESGLKRSSSKEKENVLFVKLKRKNGMPDRSIKRRHTVGGTKDFDKLPWLDNRLQCEESE
NEKSLKSKEKRSLRTSSPDLSSSRLKATIESEGLSIEVSLLGSRGNVLATLRKPLIPPSP
SGRPQSMPPVSQIFKLPLESHV
Download sequence
Identical sequences E0VFY7
121224.XP_002425031 vb|PHUM169920-PA|EEB12293.1|conserved XP_002425031.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]