SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM173280-PA|EEB12351.1|Lipid from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM173280-PA|EEB12351.1|Lipid
Domain Number 1 Region: 36-242
Classification Level Classification E-value
Superfamily Acid phosphatase/Vanadium-dependent haloperoxidase 1.57e-34
Family Type 2 phosphatidic acid phosphatase, PAP2 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM173280-PA|EEB12351.1|Lipid
Sequence length 260
Comment phosphate phosphatase, putative|DS235131.1:177440:178816:1|gene:PHUM173280
Sequence
MPTAKYLSEYFAIDILLRLFLFSLYGVFQLIPPFKRVIHPEEVWLYKNPVTASYCPIKIL
WEIVVVTPSATIFANYIFSKNRIDLIQAFLAFSLTLCLNGALTNILKVVVGRPRPDYYYR
CFPTGEGHPQIEFCTGDINVVHEGLKSFPSGHSSIAFASLGFLSLYLAGKMHLFAPSGKG
STWKLLLFLCPLFSASLVAISRLCDYHHHWQDVLCGSILGFTICWLCYHNYYPSLQDEHC
HLPWVQINKKQIKELTVKDI
Download sequence
Identical sequences E0VG45
XP_002425089.1.24195 vb|PHUM173280-PA|EEB12351.1|Lipid 121224.XP_002425089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]