SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for vb|PHUM175070-PA|EEB12391.1|conserved from Pediculus humanus corporis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  vb|PHUM175070-PA|EEB12391.1|conserved
Domain Number 1 Region: 15-193
Classification Level Classification E-value
Superfamily RUN domain-like 9.68e-36
Family RUN domain 0.0016
Further Details:      
 
Domain Number 2 Region: 504-596
Classification Level Classification E-value
Superfamily PX domain 3.53e-24
Family PX domain 0.00063
Further Details:      
 
Weak hits

Sequence:  vb|PHUM175070-PA|EEB12391.1|conserved
Domain Number - Region: 351-479
Classification Level Classification E-value
Superfamily t-snare proteins 0.0628
Family t-snare proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) vb|PHUM175070-PA|EEB12391.1|conserved
Sequence length 619
Comment hypothetical protein|DS235132.1:182853:185219:-1|gene:PHUM175070
Sequence
MADVASSKPSAIHEKERHQLLNNLLGSVKQCQTRFGGRSELATESDQLVFNLCRSLEAVL
NHGLRSRPQPKNSSTFEQVTGLVANTFRYSKEVPCFWHYVKQHLNKHELERFSSLKEVWT
DVGKGRAWLRSSLNERSLNRYMQSLLSKPDDALVYYHEWSLLLDQELNSTLPNIAAGLSS
VFFAIGINEKKLNGSIENVDDCHLSKSEPILVIPVKEAQTNHRRRKTTGQVISFENDVED
ENLLDSYSAPPTCLSSSAQSASYLCSSSEQKSFDYFYPVKKPDQTSHSSNDSSFQDFDSI
SKIESIVEEKPVEVMRTLIPLNDNVGELILISEDQISEDVVDKPFKAEDIETVLNSLEEV
KDINSRLKTKLVSLAQQKKEENSKLQSRLQTLTRENEVLKHQLRKYVEAVQMLNKDGTAA
HEALACLEAGKDALLDRAEAMQYEQKLVQVAEMHGELIEFNDKLQRIIQAKENVIKRLER
ELTDLRGPIPSTLLWEEGIISFPEILINICIPSVFLTGGSSDIHHVYQVCVRIRDNEWNI
YRRYKEFYKLHKDLRKEYPMVGTLDFPPKKTVGNKDAKFVEERRIRLQHYLRQMIDVVSK
SRSDLADSKSLSMIIPFFS
Download sequence
Identical sequences E0VG85
121224.XP_002425129 vb|PHUM175070-PA|EEB12391.1|conserved XP_002425129.1.24195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]